[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49674.1
DDBJ      :             nucleoside recognition domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  167/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   43->150 PF07670 * Gate 3.5e-10 20.0 100/109  
:BLT:SWISS 1->181 SPMA_BACSU 1e-40 43.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49674.1 GT:GENE ABO49674.1 GT:PRODUCT nucleoside recognition domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1213225..1213815 GB:FROM 1213225 GB:TO 1213815 GB:DIRECTION + GB:PRODUCT nucleoside recognition domain protein GB:NOTE PFAM: nucleoside recognition domain protein KEGG: mta:Moth_1356 nucleoside recognition GB:PROTEIN_ID ABO49674.1 GB:DB_XREF GI:134051703 InterPro:IPR011642 LENGTH 196 SQ:AASEQ MVNYVWLGMVVFGILVAGAQGHIEVVTKAALDGAQIAVQTSLSLIAIITFWLGIMKLAEAAGLVQGLAKVVRPITGFLFPSIPKDHPAMGAIVMNLSANILGLGNAATPMGLIAMQELQKLNKHRPDTASEAMCTFLALNTGCITIIPTTIIGIRVLYGSQEPTEIVGTTVFATLCGMIVAILADRLLRSLYRNRW GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 1->181|SPMA_BACSU|1e-40|43.9|180/100| TM:NTM 4 TM:REGION 1->23| TM:REGION 30->52| TM:REGION 134->156| TM:REGION 166->188| SEG 141->154|tgcitiipttiigi| HM:PFM:NREP 1 HM:PFM:REP 43->150|PF07670|3.5e-10|20.0|100/109|Gate| OP:NHOMO 168 OP:NHOMOORG 167 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-111---1-11--11111--------------------------------------1---------------1-----1--------------------111111111111111111111111111111-1--------11------------------------------------------------------------------------------------------11211111111111111111111111--1--11111111111111111-------------------------------------------------------------------------------------------1-------------------------------------11111------------------------1111--1111-1111---1----1----1------------1---------------1-1------------1----------------------------------1----1111111111111111111----1-1--------------------------------------------------------------------------------------------1-----1111-1----------------------------1-11111111111111111----------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 119-128,195-197| PSIPRED cHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //