[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49675.1
DDBJ      :             nucleoside recognition domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  171/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   47->141 PF07670 * Gate 2.8e-09 10.5 95/109  
:HMM:PFM   4->59 PF09300 * Tecti-min-caps 0.00086 37.7 53/84  
:BLT:SWISS 3->176 SPMB_BACSU 3e-48 50.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49675.1 GT:GENE ABO49675.1 GT:PRODUCT nucleoside recognition domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1213820..1214350 GB:FROM 1213820 GB:TO 1214350 GB:DIRECTION + GB:PRODUCT nucleoside recognition domain protein GB:NOTE PFAM: nucleoside recognition domain protein KEGG: mta:Moth_1355 nucleoside recognition GB:PROTEIN_ID ABO49675.1 GB:DB_XREF GI:134051704 InterPro:IPR011642 LENGTH 176 SQ:AASEQ MYELINQISRWAIPVMLLFIPLLAFIKKVPVFETFVEGAEAGFSTAIKTIPFLTAMLVAVSIFRASGAMELLASWISPVLNMVGIPADILPHAVMRPLSGGAALGIATEIIKTHGPDSFVGRLVSTMQGSSDTTFYVLTLYFGSVGIRKYRYAVASGLTADFTTLIASIMICKLMF GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 3->176|SPMB_BACSU|3e-48|50.0|174/100| TM:NTM 4 TM:REGION 5->26| TM:REGION 42->64| TM:REGION 71->93| TM:REGION 153->175| HM:PFM:NREP 2 HM:PFM:REP 47->141|PF07670|2.8e-09|10.5|95/109|Gate| HM:PFM:REP 4->59|PF09300|0.00086|37.7|53/84|Tecti-min-caps| OP:NHOMO 173 OP:NHOMOORG 172 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-111---1-11--11111--------------------------------------1---------------1-----1--------------------111111111111111111111111111111-1--------11------------------------------------------------------------------------------------------11211111111111111111111111--1--11111111111111111-------------------------------------------------------------------------------------------1-------------------------------------11111------------------------1111--1111-1111---1----1----1------------1---------------1-1------1111--1----------------------------------1----1111111111111111111----1-1--------------------------------------------------------------------------------------------1-----1111-1----------------------------1-11111111111111111----------------------------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //