[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49677.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:121 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   42->54 PF00751 * DM 0.00092 38.5 13/47  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49677.1 GT:GENE ABO49677.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1215464..1215829 GB:FROM 1215464 GB:TO 1215829 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49677.1 GB:DB_XREF GI:134051706 LENGTH 121 SQ:AASEQ MALSHEPWPMAHGLRRVPTKELLKLMANKHVRVNEVASGGIKMPYCKKCGNHESLASSYFLPSSETATAPPYGLLGNFNQEGYLTTLECQGASLDDAQEAFERPEIYFDTCPSCGSHDIHW GT:EXON 1|1-121:0| HM:PFM:NREP 1 HM:PFM:REP 42->54|PF00751|0.00092|38.5|13/47|DM| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,117-119| PSIPRED cccccccccHHHHHHHccHHHHHHHHHcccEEEEHHccccccccHHHHcccHHHHHHHccccccccccccccHHHccccccccEEEEEEcccccHHHHHHHHcccEEEEcccccccccccc //