[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49678.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 79->149 UBP12_SCHPO 1e-04 32.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49678.1 GT:GENE ABO49678.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1215896..1216354 GB:FROM 1215896 GB:TO 1216354 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: chy:CHY_1935 hypothetical protein GB:PROTEIN_ID ABO49678.1 GB:DB_XREF GI:134051707 LENGTH 152 SQ:AASEQ MSLQKEDITHRPLRVRVRLDFKGIGKPGRFLFGGKPGDKAAEDLREQQVAVFRNVPIQGIQVEEIDMSSEVYVVQDEVTNSEAAYAPVILELRAETLEDVIRFIARDDFRKIEIIEPVNLALTKYDVERLLFRVAEEMRVYRSLLERKFNHR GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 79->149|UBP12_SCHPO|1e-04|32.4|71/979| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,150-153| PSIPRED ccccccccccccEEEEEEEEEEcccccccEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEEEccccccccEEccEEEEEEcccHHHHHHHHcccccEEEEEEcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHccc //