[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49679.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   8->135 PF09021 * HutP 4e-17 46.1 %
:HMM:PFM   8->135 PF09021 * HutP 2.5e-45 46.1 128/130  
:BLT:SWISS 24->62 C93A3_SOYBN 3e-04 41.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49679.1 GT:GENE ABO49679.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1216603..1217025 GB:FROM 1216603 GB:TO 1217025 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: chy:CHY_1933 hypothetical protein GB:PROTEIN_ID ABO49679.1 GB:DB_XREF GI:134051708 LENGTH 140 SQ:AASEQ MSLHGSRKVAKAAIEMSMTETREQEKEYKTRFLAGGIRTAAVDYGGDFISSINRIIERAVVAAKREGVIKEVHADEGAVAGATREALSIIVPKAVGLNVGGKIGIARQEDHISVAVFFGVGLLHLDEVAIGLGHRAVSSS GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 24->62|C93A3_SOYBN|3e-04|41.0|39/100| RP:PFM:NREP 1 RP:PFM:REP 8->135|PF09021|4e-17|46.1|128/130|HutP| HM:PFM:NREP 1 HM:PFM:REP 8->135|PF09021|2.5e-45|46.1|128/130|HutP| OP:NHOMO 30 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---111111111111-11-----11-----1-111111--1111-1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,19-30,137-141| PSIPRED ccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccHHHccc //