[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49692.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:54 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   14->36 PF04299 * FMN_bind_2 0.00042 26.1 23/169  
:BLT:SWISS 1->54 YPZH_BACSU 7e-05 24.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49692.1 GT:GENE ABO49692.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1229861..1230025 GB:FROM 1229861 GB:TO 1230025 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49692.1 GB:DB_XREF GI:134051721 LENGTH 54 SQ:AASEQ MAAVTIVPDNIQGDVPIIIAKDEDDREKLAGHIANVLQSTVHDLGNGTYIIVQH GT:EXON 1|1-54:0| BL:SWS:NREP 1 BL:SWS:REP 1->54|YPZH_BACSU|7e-05|24.1|54/64| HM:PFM:NREP 1 HM:PFM:REP 14->36|PF04299|0.00042|26.1|23/169|FMN_bind_2| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccEEEEEcccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHccccEEEEEEc //