[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49704.1
DDBJ      :             glutamate 5-kinase
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  722/915 : Eukaryota  176/199 : Viruses  0/175   --->[See Alignment]
b.122.1c.73.1d.276.1
:366 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->339 2j5tD PDBj 1e-65 39.2 %
:RPS:PDB   5->253 2akoA PDBj 3e-35 30.5 %
:RPS:PDB   279->330 2as0A PDBj 4e-07 27.5 %
:RPS:SCOP  5->256 2akoA1  c.73.1.3 * 3e-35 31.4 %
:RPS:SCOP  228->356 1rylA  d.276.1.1 * 3e-20 13.9 %
:HMM:SCOP  5->258 2akoA1 c.73.1.3 * 5.2e-71 47.2 %
:HMM:SCOP  276->351 2cx1A1 b.122.1.1 * 1.5e-16 44.0 %
:RPS:PFM   6->217 PF00696 * AA_kinase 2e-12 32.2 %
:RPS:PFM   277->339 PF01472 * PUA 6e-11 45.2 %
:HMM:PFM   6->235 PF00696 * AA_kinase 1.4e-48 35.8 218/243  
:HMM:PFM   277->341 PF01472 * PUA 2.3e-20 42.2 64/74  
:BLT:SWISS 5->363 PROB2_BACLD 3e-72 42.1 %
:PROS 207->224|PS00902|GLUTAMATE_5_KINASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49704.1 GT:GENE ABO49704.1 GT:PRODUCT glutamate 5-kinase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1243396..1244496) GB:FROM 1243396 GB:TO 1244496 GB:DIRECTION - GB:PRODUCT glutamate 5-kinase GB:NOTE KEGG: shw:Sputw3181_0971 glutamate 5-kinase TIGRFAM: glutamate 5-kinase PFAM: aspartate/glutamate/uridylate kinase; PUA domain containing protein GB:PROTEIN_ID ABO49704.1 GB:DB_XREF GI:134051733 InterPro:IPR001048 InterPro:IPR001057 InterPro:IPR002478 InterPro:IPR005715 LENGTH 366 SQ:AASEQ MEQHRRIVIKIGSSSLTNREKLLDEYKLKALASAVAKLFNQGWQPILVSSGAVAAGLGHLGWNCTHLTMPERQAAAAVGQGLLMEKYNELFQSLGIKVGQILLTRADFADRKRYLNARNTLNVLLNRHVLPIVNENDTVTFAEIRFGDNDTLSALVAGLVEAELLILLTDIDGLYNGDPRKDPNAKLIPVVQHIDDSIIKLAGDSGSTVGTGGMKTKLAAARIAARSGIRTVVASAKEPSILSGIATGEKLGTSFEPSDHTLRSRKQWIAYGSITRGTLLIDKGAVKALTERHKSLLAVGIIGIKGDFTAGSVVSVADEQGVVLAKGITNLSSEDLRLVNKNTRHGLEVINRDWLVCERGFSICQM GT:EXON 1|1-366:0| BL:SWS:NREP 1 BL:SWS:REP 5->363|PROB2_BACLD|3e-72|42.1|359/373| PROS 207->224|PS00902|GLUTAMATE_5_KINASE|PDOC00701| SEG 27->38|klkalasavakl| SEG 152->168|lsalvaglveaellill| SEG 219->226|aaariaar| BL:PDB:NREP 1 BL:PDB:REP 7->339|2j5tD|1e-65|39.2|332/365| RP:PDB:NREP 2 RP:PDB:REP 5->253|2akoA|3e-35|30.5|233/237| RP:PDB:REP 279->330|2as0A|4e-07|27.5|51/382| RP:PFM:NREP 2 RP:PFM:REP 6->217|PF00696|2e-12|32.2|202/244|AA_kinase| RP:PFM:REP 277->339|PF01472|6e-11|45.2|62/74|PUA| HM:PFM:NREP 2 HM:PFM:REP 6->235|PF00696|1.4e-48|35.8|218/243|AA_kinase| HM:PFM:REP 277->341|PF01472|2.3e-20|42.2|64/74|PUA| GO:PFM:NREP 2 GO:PFM GO:0008652|"GO:cellular amino acid biosynthetic process"|PF00696|IPR001048| GO:PFM GO:0003723|"GO:RNA binding"|PF01472|IPR002478| RP:SCP:NREP 2 RP:SCP:REP 5->256|2akoA1|3e-35|31.4|239/241|c.73.1.3| RP:SCP:REP 228->356|1rylA|3e-20|13.9|115/157|d.276.1.1| HM:SCP:REP 5->258|2akoA1|5.2e-71|47.2|250/0|c.73.1.3|1/1|Carbamate kinase-like| HM:SCP:REP 276->351|2cx1A1|1.5e-16|44.0|75/0|b.122.1.1|1/1|PUA domain-like| OP:NHOMO 1011 OP:NHOMOORG 906 OP:PATTERN ---------------------------111-1-----------------1111--------------- -1-1111111111111111-111111111111111111111111111-1111111111--111111111111111111--11-11111111111-------1-111-111---------------11111111111111111111-11111111111111111111111111111111111111111111111211111111-11111111222211111111--11111111--------------------1---11-1---111111-1-11111111111111111111211111111111111111-1111111111112111-------1-11-221111111--111111111111-111111--1111111111111111111111111111111111111-11111111121-1111111111121111211111111111111111111111111-----------------------------1211111111111111111111111111111111111111111111111111111111111111-111111111111-1111111111111-111111111111111111-1111111---1-------2111133111211112221222222122222111211---1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---2-----111111111111111-11111111111111111111111111111111111111--------111111111111111111111111111111111111111---------1---------------------------11--1-111111 --11111-31--111111-1111111111111111111111111111-11111111111111111111-1221111212211111111-11111111-11111311--2-2232221111111-111112A2--2211-1211111--1111111111211--111-1112122-1212E2221212331312133321 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 353 STR:RPRED 96.4 SQ:SECSTR ##cTcEEEEEEcHHHHcccccccHHHHHHHHHHHHHHHHHHHcEEEEEEccHHHHHHHHcccccTcccHHHHHHHHHHHHHHHHHHHHHHHGGGTccEEEEEEcTGGGGcHHHHHHHHHHHHHHHHTTcEEEEEEcTTTccHHHHcTTTHHHHHHHHHHTTccEEEEEEcccccccccTTTcTTcccccEEccccGTccHTcccHGGcccccHHHHHHHHHHHHHHTTcEEEEEccccHHHHHHHHccccccccccccEEEEccEEEEEEEEcccccHHHHHHHHHHHHHHTTHHTTTccEEEEEcccTTccEEEEEEGGGHHHHHHHHHHHHccccTTccccEEEEEEEEEEET########### DISOP:02AL 1-2,264-266,268-270,341-342,365-367| PSIPRED cccccEEEEEEccEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccEEEEccccccccHHHHHHHHHHHcccEEEEEEcccccccccccccccccEEEEcccccHHHHHHcccccccccccccccHHHHHHHHHHccccEEEEEccccHHHHHHHccccccEEEEEcccHHHHHHHHHHHccccccEEEEcHHHHHHHHHccccccccccEEcccccccccEEEEEcccccEEEEEEEcccHHHHHHHHcccccccEEEEcccEEEEcccccccc //