[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49705.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.114.1
:148 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  109->148 1dg3A1  a.114.1.1 * 2e-04 25.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49705.1 GT:GENE ABO49705.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1244984..1245430 GB:FROM 1244984 GB:TO 1245430 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49705.1 GB:DB_XREF GI:134051734 LENGTH 148 SQ:AASEQ MFRFPLLHDPRAVLFGITLFSQNSPGLEKQLEVFANMLEATRNSLSVIRGEMHNFEASLFSSLPASKTEFSTKPVGEQPVPITYTNPNQPSFEPTITLEPTVPSAPTVDAIEEINNQLEKQLDRLAHSNPDSINEFLNDLERLIRKYR GT:EXON 1|1-148:0| RP:SCP:NREP 1 RP:SCP:REP 109->148|1dg3A1|2e-04|25.0|40/300|a.114.1.1| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 148-149| PSIPRED cccccccccccEEEEEEEHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEccccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHc //