[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49706.1
DDBJ      :             putative regulatory protein, FmdB family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.39.1
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  6->36 1cxxA2 g.39.1.3 * 0.00057 25.8 %
:RPS:PFM   1->35 PF09723 * CxxC_CxxC_SSSS 2e-04 40.0 %
:HMM:PFM   1->42 PF09723 * CxxC_CxxC_SSSS 7.1e-18 50.0 42/42  
:BLT:SWISS 1->32 Y00D_BPT4 9e-05 40.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49706.1 GT:GENE ABO49706.1 GT:PRODUCT putative regulatory protein, FmdB family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1245675..1245890 GB:FROM 1245675 GB:TO 1245890 GB:DIRECTION + GB:PRODUCT putative regulatory protein, FmdB family GB:NOTE TIGRFAM: putative regulatory protein, FmdB family KEGG: dde:Dde_2620 hypothetical protein GB:PROTEIN_ID ABO49706.1 GB:DB_XREF GI:134051735 InterPro:IPR013429 LENGTH 71 SQ:AASEQ MPIFEFSCKACGKVFEKLQLVGREDKVMCPDCASENVEKKISAPFLPSSVGRPADSGSCSTSKDSGCQTGG GT:EXON 1|1-71:0| BL:SWS:NREP 1 BL:SWS:REP 1->32|Y00D_BPT4|9e-05|40.6|32/100| RP:PFM:NREP 1 RP:PFM:REP 1->35|PF09723|2e-04|40.0|35/41|CxxC_CxxC_SSSS| HM:PFM:NREP 1 HM:PFM:REP 1->42|PF09723|7.1e-18|50.0|42/42|CxxC_CxxC_SSSS| HM:SCP:REP 6->36|1cxxA2|0.00057|25.8|31/31|g.39.1.3|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 50-64,68-72| PSIPRED ccccEEEEHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccc //