[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49707.1
DDBJ      :             Ion transport 2 domain protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.14.1
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   210->271 2q6aB PDBj 2e-05 36.8 %
:RPS:PDB   230->266 2ahyA PDBj 8e-11 44.4 %
:RPS:SCOP  198->287 1orqC  f.14.1.1 * 6e-06 25.0 %
:HMM:SCOP  175->296 1xl4A2 f.14.1.1 * 5.2e-12 19.0 %
:HMM:PFM   221->290 PF07885 * Ion_trans_2 3.9e-10 27.6 58/79  
:BLT:SWISS 209->291 KCO6_ARATH 1e-05 28.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49707.1 GT:GENE ABO49707.1 GT:PRODUCT Ion transport 2 domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1246019..1246915 GB:FROM 1246019 GB:TO 1246915 GB:DIRECTION + GB:PRODUCT Ion transport 2 domain protein GB:NOTE PFAM: Ion transport 2 domain protein, KEGG: syn:slr0498 hypothetical protein GB:PROTEIN_ID ABO49707.1 GB:DB_XREF GI:134051736 InterPro:IPR013099 LENGTH 298 SQ:AASEQ MTLQELFSSFAVVFVLLGTVLLFMHSFAPVTRSQERQITITLDVFHLFRHISVLLKYSLLSIAQMPPLLLLFLILYGLVLSFYYWYQRMSLGLTGLLGLSILTTIISLGIIALILSPILFMTRKYLFDDMIESRIFRIAIYSVMVPFLYIFIIHDLTPGPLVEGIMFTGIVISYYQIFRGIIYCLQTPRTFFSYLDSRFIPILMIVSWLFVIIFNLYTMILLVSNTNPYSFIDSTGPVTEHIRLLYFTIITFTSVGYGDITPRGNFPVFITMIISITGFLYSALFIGGLLAAFTSRSK GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 209->291|KCO6_ARATH|1e-05|28.2|78/436| TM:NTM 8 TM:REGION 7->29| TM:REGION 39->61| TM:REGION 64->84| TM:REGION 97->119| TM:REGION 136->158| TM:REGION 163->185| TM:REGION 201->223| TM:REGION 269->291| SEG 10->23|favvfvllgtvllf| SEG 68->80|llllflilyglvl| SEG 90->119|slgltgllglsilttiislgiialilspil| BL:PDB:NREP 1 BL:PDB:REP 210->271|2q6aB|2e-05|36.8|57/103| RP:PDB:NREP 1 RP:PDB:REP 230->266|2ahyA|8e-11|44.4|27/104| HM:PFM:NREP 1 HM:PFM:REP 221->290|PF07885|3.9e-10|27.6|58/79|Ion_trans_2| RP:SCP:NREP 1 RP:SCP:REP 198->287|1orqC|6e-06|25.0|80/223|f.14.1.1| HM:SCP:REP 175->296|1xl4A2|5.2e-12|19.0|116/0|f.14.1.1|1/1|Voltage-gated potassium channels| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 26.8 SQ:SECSTR #################################################################################################################################################################################################################HHHHHHHTHHHHHHHTcccccHHHHccHHHH#HHHHHHHHHHHTTccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHT######## DISOP:02AL 1-2,294-299| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //