[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49710.1
DDBJ      :             methyl-accepting chemotaxis sensory transducer
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  379/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.92.1h.4.5
:283 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   107->279 3g6bB PDBj 5e-14 24.9 %
:RPS:PDB   99->271 2ch7A PDBj 6e-18 27.8 %
:RPS:SCOP  101->269 3cmnA1  d.92.1.16 * 2e-12 7.1 %
:HMM:SCOP  1->87 1gd1O1 c.2.1.3 * 7.6e-13 30.2 %
:HMM:SCOP  63->283 2ch7B1 h.4.5.1 * 1.8e-36 30.2 %
:RPS:PFM   150->283 PF00015 * MCPsignal 4e-12 35.9 %
:HMM:PFM   144->282 PF00015 * MCPsignal 3.9e-33 38.2 136/213  
:HMM:PFM   2->82 PF01408 * GFO_IDH_MocA 9.9e-09 27.8 79/120  
:HMM:PFM   83->170 PF09537 * DUF2383 3.9e-05 21.6 88/111  
:BLT:SWISS 109->273 HEMAT_BACSU 2e-19 34.4 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49710.1 GT:GENE ABO49710.1 GT:PRODUCT methyl-accepting chemotaxis sensory transducer GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1249728..1250579) GB:FROM 1249728 GB:TO 1250579 GB:DIRECTION - GB:PRODUCT methyl-accepting chemotaxis sensory transducer GB:NOTE PFAM: oxidoreductase domain protein; chemotaxis sensory transducer KEGG: tte:TTE0646 methyl-accepting chemotaxis protein GB:PROTEIN_ID ABO49710.1 GB:DB_XREF GI:134051739 InterPro:IPR000683 InterPro:IPR004089 LENGTH 283 SQ:AASEQ MIKVGIVGGGQGGSAMLRLMSSLTDITVIGIADINENAPAFTVAKELGIPTFLDFKQLLQSANLDVVLDVTGNASVNQAILEHKQATTHLADPVISKLMYTVARGQEESAQELKGQAQQLASMAEELNSTVHSVPSAIKSVTGALETHCEKLNSAVFQAEKHINDTDEVIEFIKKVADQTKLLGLNAAIEAARAGNHGRGFGVVANEVRKLAEDSVVSAKKISNILGNIEDSMKTIILGIDETATIAQMQQSTTDKVDEATKQLGQIADEMKVFAHKLSNFAS GT:EXON 1|1-283:0| BL:SWS:NREP 1 BL:SWS:REP 109->273|HEMAT_BACSU|2e-19|34.4|160/432| COIL:NAA 32 COIL:NSEG 1 COIL:REGION 103->134| SEG 4->13|vgivgggqgg| BL:PDB:NREP 1 BL:PDB:REP 107->279|3g6bB|5e-14|24.9|173/212| RP:PDB:NREP 1 RP:PDB:REP 99->271|2ch7A|6e-18|27.8|169/309| RP:PFM:NREP 1 RP:PFM:REP 150->283|PF00015|4e-12|35.9|131/210|MCPsignal| HM:PFM:NREP 3 HM:PFM:REP 144->282|PF00015|3.9e-33|38.2|136/213|MCPsignal| HM:PFM:REP 2->82|PF01408|9.9e-09|27.8|79/120|GFO_IDH_MocA| HM:PFM:REP 83->170|PF09537|3.9e-05|21.6|88/111|DUF2383| GO:PFM:NREP 3 GO:PFM GO:0004871|"GO:signal transducer activity"|PF00015|IPR004089| GO:PFM GO:0007165|"GO:signal transduction"|PF00015|IPR004089| GO:PFM GO:0016020|"GO:membrane"|PF00015|IPR004089| RP:SCP:NREP 1 RP:SCP:REP 101->269|3cmnA1|2e-12|7.1|168/294|d.92.1.16| HM:SCP:REP 1->87|1gd1O1|7.6e-13|30.2|86/172|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 63->283|2ch7B1|1.8e-36|30.2|215/0|h.4.5.1|1/1|Methyl-accepting chemotaxis protein (MCP) signaling domain| OP:NHOMO 1741 OP:NHOMOORG 399 OP:PATTERN ------------------------9AB5-223------46534-1--2--111---1--1-------- -3-1------------------------------------2---E---7-------------5-B-------------------4-13--------------------1-------------------------1-----------223333--1--------211-1132--------------------2B58888878AB8888896A87A6988244O746111111FB------------------------------------------------------------------------------------------4B9QSAAAA9B999D7-LKA---H99--3875-CD8E735B52--34---23-1445-----1-5CB1-68A356--------------4----711--8666876AD634W-6-5---1-1122----------223-fHb------------------------------14-122---12111126111111131111-11441211-----312----31-11111--2-3-------1111-166B4I-21--5-1-16463334643353I43----1-11-1-2----------1-3---22-32414-3-13433-2-222314-233---1147-------2333-22---------------------------------33--312111111111111111--1------111111111111-------------217A4---------------111111--118422222222122231333---------1-1112223211111--1-2---11------5TGG23552212322262--------------------------1-22211112--- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 230 STR:RPRED 81.3 SQ:SECSTR #####################################################cHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHH DISOP:02AL 1-1,60-164,217-218,228-258,267-277,279-284| PSIPRED cccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //