[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49724.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->71 1u3eM PDBj 7e-04 42.2 %
:HMM:PFM   6->58 PF08605 * Rad9_Rad53_bind 0.00026 26.0 50/131  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49724.1 GT:GENE ABO49724.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1265068..1265328 GB:FROM 1265068 GB:TO 1265328 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49724.1 GB:DB_XREF GI:134051753 LENGTH 86 SQ:AASEQ MDRKIVQISFAGNYEVLYDFFTDLDLQIGDPVVCHTVRGYNVGKVVGFVDGSTKATNWIVQKVDVEGHMQRLAKIRQAKELEELLG GT:EXON 1|1-86:0| BL:PDB:NREP 1 BL:PDB:REP 27->71|1u3eM|7e-04|42.2|45/174| HM:PFM:NREP 1 HM:PFM:REP 6->58|PF08605|0.00026|26.0|50/131|Rad9_Rad53_bind| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 45 STR:RPRED 52.3 SQ:SECSTR ##########################EHHHHHHHHHcTTccTTcEEEETTccTTGGGEEcHHHHHHHHHHH############### DISOP:02AL 1-2| PSIPRED cccEEEEEEEcccHHHHHHHHHccccccccEEEEEEEEcccHHHEEEEEcccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHc //