[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49733.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.204.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   53->149 3crcA PDBj 1e-05 24.5 %
:RPS:SCOP  79->155 2a3qA1  a.204.1.2 * 2e-04 22.2 %
:HMM:SCOP  58->145 1vmgA_ a.204.1.2 * 0.00039 22.9 %
:HMM:PFM   87->149 PF03819 * MazG 1.7e-05 25.4 63/74  
:HMM:PFM   5->55 PF08963 * DUF1878 0.00096 32.7 49/113  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49733.1 GT:GENE ABO49733.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1276989..1277468 GB:FROM 1276989 GB:TO 1277468 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49733.1 GB:DB_XREF GI:134051762 LENGTH 159 SQ:AASEQ MNYRKEINDLCKEINDLLDKQDNKGMEKYGMALEQNPAGILERLQHSVEEKIDDLRYTFWAMDRLKSMWVRFPRIKFVDVNSLAEQLDHVRSEHKEVWLAFEDDKIGDLAMELFDLIHSCETALRILQESFGIDLRETLLAVIDKNKKRGYYENAGKTD GT:EXON 1|1-159:0| RP:PDB:NREP 1 RP:PDB:REP 53->149|3crcA|1e-05|24.5|94/225| HM:PFM:NREP 2 HM:PFM:REP 87->149|PF03819|1.7e-05|25.4|63/74|MazG| HM:PFM:REP 5->55|PF08963|0.00096|32.7|49/113|DUF1878| RP:SCP:NREP 1 RP:SCP:REP 79->155|2a3qA1|2e-04|22.2|72/113|a.204.1.2| HM:SCP:REP 58->145|1vmgA_|0.00039|22.9|83/0|a.204.1.2|1/1|all-alpha NTP pyrophosphatases| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 94 STR:RPRED 59.1 SQ:SECSTR ####################################################ccHHHHHHHHHHHHccccccTTTTcccHHHHHH###HHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHccc########## DISOP:02AL 1-3,153-160| PSIPRED ccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccc //