[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49742.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49742.1 GT:GENE ABO49742.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1286398..1286706 GB:FROM 1286398 GB:TO 1286706 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: dsy:DSY2180 hypothetical protein GB:PROTEIN_ID ABO49742.1 GB:DB_XREF GI:134051771 LENGTH 102 SQ:AASEQ MGFKDYAAADIAVFVNVDEMADSHDIDGQQIPAIVDSDVLSGQSEYRDGIYLGEILVFVRSSDLPSRPVKNQHMRLDGELYLVSNCSEEDGLLQITLEANEA GT:EXON 1|1-102:0| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------1------------------1--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,100-103| PSIPRED cccccccccEEEEEEEHHHHccccccccccccEEEcccHHcccccccccEEEEEEEEEEEccccccccccccEEEEccEEEEEEcccccccEEEEEEEcccc //