[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49751.1
DDBJ      :             phage baseplate assembly protein V
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->84 PF04717 * Phage_base_V 6.8e-16 30.8 78/79  
:HMM:PFM   107->145 PF05606 * DUF777 0.00083 17.9 39/180  
:BLT:SWISS 44->131 VPV_BPP2 3e-12 35.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49751.1 GT:GENE ABO49751.1 GT:PRODUCT phage baseplate assembly protein V GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1294841..1295320 GB:FROM 1294841 GB:TO 1295320 GB:DIRECTION + GB:PRODUCT phage baseplate assembly protein V GB:NOTE PFAM: phage baseplate assembly protein V KEGG: sgl:SG0853 putative phage baseplate protein GB:PROTEIN_ID ABO49751.1 GB:DB_XREF GI:134051780 InterPro:IPR006531 InterPro:IPR013046 LENGTH 159 SQ:AASEQ MDLIRVGQISSVNPEKCTARVMFQDKSDVVSYDLPVMVRGSLNNKDYWIPAPGEQVICLFLSSGVAQGFVLGSIYSEKDKPPVKDSNKRHISFSDGTKIEYDAATHTLTVNATGPVNIVAAGNVNVTGDVIADGISLKKHIHDGVMGGSSSTNPPVGGG GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 44->131|VPV_BPP2|3e-12|35.2|88/100| HM:PFM:NREP 2 HM:PFM:REP 7->84|PF04717|6.8e-16|30.8|78/79|Phage_base_V| HM:PFM:REP 107->145|PF05606|0.00083|17.9|39/180|DUF777| OP:NHOMO 74 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------1--------------------------------------------1-----------------------------------------------2-------1--------------------------------------------------------------------------------------------------------------1111------------11--111-2-12-11-211---12-1----1---1121222112-------1-1------------------------1--1------1-----1-------11----1------------------------------------------2--1---1112222----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1--------------------------1---11---------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 146-160| PSIPRED ccEEEEEEEEEEcccccEEEEEEcccccEEEEcHHHHHHcccccEEEEccccccEEEEEEccccccccEEEEEEEccccccccccccEEEEEcccccEEEEEccccEEEEEEEEEEEEEEcccEEEEccEEEccEEEEEEEcccccccccccccccccc //