[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49755.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:649 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   52->155 PF09684 * Tail_P2_I 4e-11 34.3 %
:HMM:PFM   39->155 PF09684 * Tail_P2_I 8.1e-19 27.6 116/139  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49755.1 GT:GENE ABO49755.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1297147..1299096 GB:FROM 1297147 GB:TO 1299096 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: cvi:CV0420 probable phage tail protein GB:PROTEIN_ID ABO49755.1 GB:DB_XREF GI:134051784 LENGTH 649 SQ:AASEQ MSKSIYDVSLLDIMPQSLLADPFIKAMAMALDPELQAISSEIILCSLLPRIDDLPEDIVNHLLVQFHVDFCYSDLTLDQKRTLVKQALPWHRRKGTPAMVEEVVSVLFGGDAKVSEWFEYGGQPFYFKIKTEAIDTTPAHLEAIRKAVNLAKNSRSWLQSIGFLLNLKEEVNLELTLQSSIPIADFKEAVLRPGFRHCTDAKIYRDVFGIIDYKSVVNHNGKFLHLNDEQVLEVITEPSGIPRAGVRYAGTIDYNGQIIHDSSLNHDTKPDTWVPHEYTALGEDEESATVSVTPNLSDAQEHWIYYSADWKHNENYHGPRAAHSRIGSIDATLATSDTVDTQELKQLSLTRDFVDNLTGRPRIHGPVGMEAYARGFRHDISFPRNELNLRWGLFKYWGSIKRSILWKHDGSINYSYFEGERSTDVSVSMAAETTAVAPKYNGLHRHTTNGLSGTSRLPGPVNDCVVEPLEASLQYIDQVPDADGIVQENANITIHAEELFNRKSRQHDGELLYTGKGPRSGPFVYNGVYLHEQTAENSLNKAAITLSDMSCRRRYGGIFNAHNRGRRWYHTGQLLRRPFGRHGSAWQHDSLQRYLEGCARYGDPAYMHDGIDSYGFPRLVHDGSVLRLEMVPEERMQLNIRRGYRRVAA GT:EXON 1|1-649:0| SEG 164->177|llnlkeevnleltl| RP:PFM:NREP 1 RP:PFM:REP 52->155|PF09684|4e-11|34.3|102/133|Tail_P2_I| HM:PFM:NREP 1 HM:PFM:REP 39->155|PF09684|8.1e-19|27.6|116/139|Tail_P2_I| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------1---------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------------------1-------------------------------------------------------------------------------------------------------------------------1111----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,648-650| PSIPRED ccccEEEEEHHHHccccccccccccHHHHHHHHHHHHHcccEEEEcccccHHHccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEEccccccccEEEEEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEEEEccccccEEEEEcccccccccccHHHHccccccccccHHcccEEEEEEHHHHcccccEEEEEcHHHHHHHHHccccccccccEEEEEEEcccEEEEcccccccccccccccccHHccccccccEEEEEccccccccEEEEEEEccccccccccccHHHHcccccccEEEEccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccccEEEHHHHHHHHHHHEEEEEccccEEEEEEcccccccEEEEEEcccccccccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEccccEEEEHHHHHHHHHHcccccEEEEccccccccEEEEEEEEEcHHHcccccEEEEEEcccHHHHHHccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHcccccccccEEEccccEEEEEEccHHHHEEHHHHHHHHHcc //