[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49760.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->69 PF08623 * TIP120 0.00036 37.8 37/169  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49760.1 GT:GENE ABO49760.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1302073..1302375 GB:FROM 1302073 GB:TO 1302375 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: shw:Sputw3181_2466 hypothetical protein GB:PROTEIN_ID ABO49760.1 GB:DB_XREF GI:134051789 LENGTH 100 SQ:AASEQ MIVYGYTALRQFPKSEKHTLAADIKQSMYRLLSLVITTNKKYYKKTTMQELDVELDFLRSLVRLSMQLKFLPFKKYELWAGMLNEIGRMIGGWLKSIRQQ GT:EXON 1|1-100:0| SEG 37->47|ttnkkyykktt| HM:PFM:NREP 1 HM:PFM:REP 33->69|PF08623|0.00036|37.8|37/169|TIP120| OP:NHOMO 9 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------11-----------------------------------------------------------------------------------2-------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 98-101| PSIPRED cEEEHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //