[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49764.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->64 PF08744 * NOZZLE 0.00057 42.9 35/314  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49764.1 GT:GENE ABO49764.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1306950..1307228) GB:FROM 1306950 GB:TO 1307228 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49764.1 GB:DB_XREF GI:134051793 LENGTH 92 SQ:AASEQ MAGLNALRSFLISFILLFIKDGGVMAKGGARPGAGRKPGSKSTSQPRKMRGIKVTDKEWKKIGELAFKAGYIKPSGEPNASEYIRKRALREI GT:EXON 1|1-92:0| TM:NTM 1 TM:REGION 1->22| SEG 9->19|sflisfillfi| SEG 26->39|akggarpgagrkpg| HM:PFM:NREP 1 HM:PFM:REP 30->64|PF08744|0.00057|42.9|35/314|NOZZLE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,28-51,91-93| PSIPRED ccHHHHHHHHHHHHHHHHHHcccEEcccccccccccccccccccccHHHccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcc //