[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49778.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->78 1m1jF PDBj 2e-04 37.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49778.1 GT:GENE ABO49778.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1318328..1318591) GB:FROM 1318328 GB:TO 1318591 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49778.1 GB:DB_XREF GI:134051807 LENGTH 87 SQ:AASEQ MTNKLYRINPRYRQYNEPSPFEEMDGFGETSNNHLNTFWRVNQDGHMWLAESCVRGACDRKVFKVCSEAEKWARDYAYSKAKSWGGF GT:EXON 1|1-87:0| BL:PDB:NREP 1 BL:PDB:REP 25->78|1m1jF|2e-04|37.0|54/389| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 54 STR:RPRED 62.1 SQ:SECSTR ########################HcEEcccTTccccEEccHHHHHHHHTccccEEEEEEEccEEccTTTTccEEccE######### DISOP:02AL 1-3,87-88| PSIPRED ccccEEEEcHHHHcccccccHHHHHcccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //