[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49779.1
DDBJ      :             FAD dependent oxidoreductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:350 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->36 1sezA PDBj 5e-05 45.7 %
:RPS:PDB   3->329 3cgvA PDBj 2e-10 11.3 %
:RPS:SCOP  1->37 2ivdA1  c.3.1.2 * 3e-12 43.2 %
:RPS:SCOP  131->293 3c96A1  c.3.1.2 * 1e-10 14.2 %
:HMM:SCOP  1->283 1k0iA1 c.3.1.2 * 1.1e-19 27.9 %
:RPS:PFM   3->44 PF00743 * FMO-like 4e-06 52.4 %
:HMM:PFM   3->37 PF01266 * DAO 9.6e-09 47.1 34/358  
:BLT:SWISS 3->140 TRMFO_LAWIP 1e-07 29.1 %
:BLT:SWISS 169->299 GGR2_METST 3e-06 30.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49779.1 GT:GENE ABO49779.1 GT:PRODUCT FAD dependent oxidoreductase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1318745..1319797) GB:FROM 1318745 GB:TO 1319797 GB:DIRECTION - GB:PRODUCT FAD dependent oxidoreductase GB:NOTE PFAM: FAD dependent oxidoreductase KEGG: tte:TTE0281 dehydrogenase (flavoproteins) GB:PROTEIN_ID ABO49779.1 GB:DB_XREF GI:134051808 InterPro:IPR000437 InterPro:IPR001100 InterPro:IPR006076 InterPro:IPR013027 LENGTH 350 SQ:AASEQ MRVAIIGAGITGLACAIELEKYGIRPVIFEKNHRIGSPFPYAPLLLDFIFRPIKRPLHTLKTQYNIKLKPISDIRFMRVQGPQAQFSTGGNLGYSLLQGQEIHSIESQMASHLKTSIQFETPVKPEDILKQYDYVVVATGNKEYAHQLGIWQNTYQSWVRGATILGRFNPQEIRFWFNKNYTKGGYAYMVPMGIERATLMLSVADTTQDKLAEFWQKFIDQEKLDPEIVLLWDVAFNTGEVFPHRVGNTFFVGNSGGFVTSWLGEGTFSSIMSGIEAARSIATGCPFEKRMKEITQIMERQARFRSLWDKFDNKGIDRAIRLMGSPLIQYPLYHTNLNFFKAIDHFNDRY GT:EXON 1|1-350:0| BL:SWS:NREP 2 BL:SWS:REP 3->140|TRMFO_LAWIP|1e-07|29.1|134/445| BL:SWS:REP 169->299|GGR2_METST|3e-06|30.5|128/393| BL:PDB:NREP 1 BL:PDB:REP 2->36|1sezA|5e-05|45.7|35/456| RP:PDB:NREP 1 RP:PDB:REP 3->329|3cgvA|2e-10|11.3|327/370| RP:PFM:NREP 1 RP:PFM:REP 3->44|PF00743|4e-06|52.4|42/247|FMO-like| HM:PFM:NREP 1 HM:PFM:REP 3->37|PF01266|9.6e-09|47.1|34/358|DAO| GO:PFM:NREP 4 GO:PFM GO:0004499|"GO:flavin-containing monooxygenase activity"|PF00743|IPR000960| GO:PFM GO:0050660|"GO:FAD binding"|PF00743|IPR000960| GO:PFM GO:0050661|"GO:NADP or NADPH binding"|PF00743|IPR000960| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00743|IPR000960| RP:SCP:NREP 2 RP:SCP:REP 1->37|2ivdA1|3e-12|43.2|37/341|c.3.1.2| RP:SCP:REP 131->293|3c96A1|1e-10|14.2|162/269|c.3.1.2| HM:SCP:REP 1->283|1k0iA1|1.1e-19|27.9|147/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 22 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------2-----1-1142---12-222------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 331 STR:RPRED 94.6 SQ:SECSTR cEEEEEcccHHHHHHHHHHHHTTccEEEcccccTTcccccccEEETHHHHHTTccccTTTEEEEEcEEEEEcTTccccEEEccccEEEEcHHHHHHHHTcEEEcccEEEEEEETTEEEEEEEEETTEEEEEEEEEEEcccTTcHHHHHHTccTTGGEEEEEEEEEcccccTTEEEEEccTTcTTEEEEEEEEETTEEEEEEEETTTcHHHHHHHHHHHHHTcHHHHTcEEEEEEEEEEEcccccccETTEEcGGGGTcccTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHTTcccccc################### DISOP:02AL 350-351| PSIPRED cEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccccccccccHHHHHcccccHHHHHHHHHccccEEEEEEEEEEEEEcccEEEEEcccEEEEEEEccHHHHHHHHHHcccEEEEEEEccccHHHEEHHccEEEEccccccHHHHHcccccccEEEEEEEEEEccccccEEEEEEccccccccEEEEEEEcccEEEEEEEEcccccccHHHHHHHHHHHccccccEEEEEEEccccccccEEEEccEEEEEccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHccccccHHHHHHHHcccc //