[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49780.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  31->87 2fzfA1 a.25.1.1 * 0.00019 28.1 %
:HMM:PFM   30->84 PF09537 * DUF2383 1.7e-06 35.3 51/111  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49780.1 GT:GENE ABO49780.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1319854..1320117 GB:FROM 1319854 GB:TO 1320117 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49780.1 GB:DB_XREF GI:134051809 LENGTH 87 SQ:AASEQ MPKITQCKRDEYKGGGEFIVAKLTQKEIQNNLLKQAYDGEVLRQAKYSYLMDIIKDKRLKKLFKVFAMTARGHIAELKQEMQNLDIK GT:EXON 1|1-87:0| HM:PFM:NREP 1 HM:PFM:REP 30->84|PF09537|1.7e-06|35.3|51/111|DUF2383| HM:SCP:REP 31->87|2fzfA1|0.00019|28.1|57/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,85-88| PSIPRED cccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //