[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49781.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:74 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->52 1u7mA PDBj 2e-04 28.6 %
:RPS:SCOP  5->67 1zpyA1  a.25.1.5 * 7e-05 20.6 %
:HMM:SCOP  1->66 1vjxA_ a.25.1.1 * 1.7e-06 27.7 %
:HMM:PFM   5->72 PF09537 * DUF2383 1.5e-07 26.5 68/111  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49781.1 GT:GENE ABO49781.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1320129..1320353 GB:FROM 1320129 GB:TO 1320353 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: tte:TTE0279 hypothetical protein GB:PROTEIN_ID ABO49781.1 GB:DB_XREF GI:134051810 LENGTH 74 SQ:AASEQ MDNLEFLNDALEDKIRNQTFYNDGAIRVRNPSTKQLLLKLRDEEMKHIEVLQKEIVAIENKPFTVTKILAKLKS GT:EXON 1|1-74:0| BL:PDB:NREP 1 BL:PDB:REP 4->52|1u7mA|2e-04|28.6|49/53| HM:PFM:NREP 1 HM:PFM:REP 5->72|PF09537|1.5e-07|26.5|68/111|DUF2383| RP:SCP:NREP 1 RP:SCP:REP 5->67|1zpyA1|7e-05|20.6|63/91|a.25.1.5| HM:SCP:REP 1->66|1vjxA_|1.7e-06|27.7|65/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 66.2 SQ:SECSTR ###ccTHHHHHHHHHHHHHHHHHHHHHTccTTGGGTHHHHHHHHHHHHHHHH###################### DISOP:02AL 1-2,74-75| PSIPRED ccHHHHHHHHHHHHHHHHHHHHcccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcc //