[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49785.1
DDBJ      :             transcriptional regulator, MarR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  40/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->92 2a61A PDBj 2e-08 41.4 %
:RPS:PDB   10->140 2a61A PDBj 2e-17 22.1 %
:RPS:SCOP  10->140 2a61A1  a.4.5.28 * 2e-18 22.1 %
:HMM:SCOP  5->142 1jgsA_ a.4.5.28 * 3.9e-25 34.3 %
:RPS:PFM   36->92 PF01047 * MarR 8e-09 45.6 %
:HMM:PFM   36->94 PF01047 * MarR 8e-19 35.6 59/59  
:BLT:SWISS 36->143 YSMB_BACSU 8e-11 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49785.1 GT:GENE ABO49785.1 GT:PRODUCT transcriptional regulator, MarR family GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1323429..1323896) GB:FROM 1323429 GB:TO 1323896 GB:DIRECTION - GB:PRODUCT transcriptional regulator, MarR family GB:NOTE PFAM: regulatory protein, MarR KEGG: tte:TTE2515 transcriptional regulator GB:PROTEIN_ID ABO49785.1 GB:DB_XREF GI:134051814 InterPro:IPR000835 LENGTH 155 SQ:AASEQ MEQELIRQAEHLNFLIRTLNRKFRQYMLSQTVGCGLTVPQLHLMQELFQNPGITLGDLSIRLGLAKSTVSGIVDRLEKQGKVVRKRNDQDRRVVHIDLAPEVNEMNYNLALMRTNYLAGFLTSMAPVEIEGLINGLEKINFLMVQETNSLNNHSG GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 36->143|YSMB_BACSU|8e-11|33.3|108/146| BL:PDB:NREP 1 BL:PDB:REP 35->92|2a61A|2e-08|41.4|58/142| RP:PDB:NREP 1 RP:PDB:REP 10->140|2a61A|2e-17|22.1|131/142| RP:PFM:NREP 1 RP:PFM:REP 36->92|PF01047|8e-09|45.6|57/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 36->94|PF01047|8e-19|35.6|59/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 10->140|2a61A1|2e-18|22.1|131/139|a.4.5.28| HM:SCP:REP 5->142|1jgsA_|3.9e-25|34.3|137/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 48 OP:NHOMOORG 40 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------11------11--111111-1------------------------------------------------------------------------------------------11--2------------221--------2------12-----12112----------------------------------------------------1-------------------------------------------------------------------------1-1-------------------------------------------------------------------------1--------------1------1--1-11-------------------------------------1-2----------------------1----------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------1------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 91.6 SQ:SECSTR cccHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHH############# DISOP:02AL 1-3,143-156| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //