[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49786.1
DDBJ      :             L-serine ammonia-lyase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  180/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.18d.81.2
:221 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->70 2iqqA PDBj 1e-05 43.1 %
:BLT:PDB   150->219 1ygyA PDBj 9e-05 22.9 %
:RPS:PDB   19->219 3dc2A PDBj 3e-15 15.4 %
:RPS:SCOP  19->126 2iafA1  d.81.2.1 * 1e-18 31.8 %
:RPS:SCOP  141->219 1psdA3  d.58.18.1 * 4e-10 22.8 %
:HMM:SCOP  19->139 2iafA1 d.81.2.1 * 3.3e-26 35.9 %
:HMM:SCOP  137->219 1psdA3 d.58.18.1 * 2.8e-15 33.7 %
:RPS:PFM   5->78 PF03315 * SDH_beta 2e-11 43.8 %
:HMM:PFM   5->137 PF03315 * SDH_beta 5.7e-32 34.9 129/158  
:HMM:PFM   150->210 PF01842 * ACT 3.3e-10 24.6 61/66  
:BLT:SWISS 1->210 SDHB_BACSU 3e-59 50.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49786.1 GT:GENE ABO49786.1 GT:PRODUCT L-serine ammonia-lyase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1324114..1324779 GB:FROM 1324114 GB:TO 1324779 GB:DIRECTION + GB:PRODUCT L-serine ammonia-lyase GB:NOTE KEGG: gka:GK1184 L-serine dehydratase (L-serine deaminase) beta chain TIGRFAM: L-serine dehydratase, iron-sulfur-dependent, beta subunit PFAM: amino acid-binding ACT domain protein; serine dehydratase beta chain GB:PROTEIN_ID ABO49786.1 GB:DB_XREF GI:134051815 InterPro:IPR002912 InterPro:IPR004643 InterPro:IPR005131 LENGTH 221 SQ:AASEQ MRYNSIFDIIGPVMVGPSSSHTAGAARIGKTTRNIFGRVPTRAEITLYGSFAQTYRGHGTDLALVGGILNLNANDENIVRSFQIAKDFGVEIIFKTVAEESDYHPNTARVCLSDSKGSLEVVGISVGGGKITITEIEGFKISLSGDSPTLLVFHHDRFGAIAKVAQVLACNEINIGHMEVARRSRGDQALMVIETDQDLTNETIKAVKRIDPEYRIALIIP GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 1->210|SDHB_BACSU|3e-59|50.7|209/220| SEG 127->138|gggkititeieg| BL:PDB:NREP 2 BL:PDB:REP 19->70|2iqqA|1e-05|43.1|51/141| BL:PDB:REP 150->219|1ygyA|9e-05|22.9|70/527| RP:PDB:NREP 1 RP:PDB:REP 19->219|3dc2A|3e-15|15.4|201/526| RP:PFM:NREP 1 RP:PFM:REP 5->78|PF03315|2e-11|43.8|73/156|SDH_beta| HM:PFM:NREP 2 HM:PFM:REP 5->137|PF03315|5.7e-32|34.9|129/158|SDH_beta| HM:PFM:REP 150->210|PF01842|3.3e-10|24.6|61/66|ACT| GO:PFM:NREP 3 GO:PFM GO:0003941|"GO:L-serine ammonia-lyase activity"|PF03315|IPR005131| GO:PFM GO:0006094|"GO:gluconeogenesis"|PF03315|IPR005131| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF03315|IPR005131| RP:SCP:NREP 2 RP:SCP:REP 19->126|2iafA1|1e-18|31.8|107/140|d.81.2.1| RP:SCP:REP 141->219|1psdA3|4e-10|22.8|79/84|d.58.18.1| HM:SCP:REP 19->139|2iafA1|3.3e-26|35.9|117/0|d.81.2.1|1/1|Serine metabolism enzymes domain| HM:SCP:REP 137->219|1psdA3|2.8e-15|33.7|83/0|d.58.18.1|1/1|ACT-like| OP:NHOMO 209 OP:NHOMOORG 183 OP:PATTERN -----------------------------------------------11---------------1--- ------------------------------------------------------------------------------1111---------------------------------------------------------------------------------------------------1-2211111--2222222111121221112111112212211111111112-1111111111111112111121--11---1111111111----11111111111--1111111111111111111111111111111111111111111111111--11122211-11-1--11112--21211111---111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------------------------1-111-1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 98.6 SQ:SECSTR ##cTTccccccccccTTTTHHHHHHHHHHHHHHHTccccccEEEEEEEEGGGGcccHHHHHHHHHHHTGGGcccccccccHHHHHHHHccEEEEEEEcccccccEEEEEEEcTTccEEEEEEEEETTTTEEEEEEETTEEEEEEcccEEEEEEEcccTTHHHHHHHHHHHTTccEEEEEEEcccccccEEEEEEEcccccHHHHHHHHHHHTccEEEEEE# DISOP:02AL 1-1| PSIPRED cccEEEEEEccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEcHHHHccccHHHHHHHHHHccccccccccccHHHHHHHccEEEEEEEccccccccccEEEEEEEEcccEEEEEEEEEccccEEEEEEccEEEEccccccEEEEEccccccHHHHHHHHHHHHcccHHHEEEEEcccccEEEEEEEccccccHHHHHHHHcccccEEEEEEcc //