[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49809.1
DDBJ      :             protein of unknown function DUF503
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  131/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.50
:93 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->81 1j27A PDBj 6e-06 25.6 %
:HMM:SCOP  1->93 1j27A_ d.58.50.1 * 1.2e-31 46.7 %
:RPS:PFM   3->87 PF04456 * DUF503 2e-19 50.6 %
:HMM:PFM   2->91 PF04456 * DUF503 2.7e-37 46.7 90/90  
:BLT:SWISS 2->84 YLXP_BACSU 1e-14 42.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49809.1 GT:GENE ABO49809.1 GT:PRODUCT protein of unknown function DUF503 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1362967..1363248 GB:FROM 1362967 GB:TO 1363248 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF503 GB:NOTE PFAM: protein of unknown function DUF503 KEGG: chy:CHY_2676 hypothetical protein GB:PROTEIN_ID ABO49809.1 GB:DB_XREF GI:134051838 InterPro:IPR007546 LENGTH 93 SQ:AASEQ MIVGIMTVELYISGATTLKEKRRVLKSIIDRIRSKYNVSISEVDNQDLWQRATLGVAAVSNETSHVSRMLDTVIRTIENNGEADLVDYSIEIL GT:EXON 1|1-93:0| BL:SWS:NREP 1 BL:SWS:REP 2->84|YLXP_BACSU|1e-14|42.2|83/100| BL:PDB:NREP 1 BL:PDB:REP 3->81|1j27A|6e-06|25.6|78/98| RP:PFM:NREP 1 RP:PFM:REP 3->87|PF04456|2e-19|50.6|85/90|DUF503| HM:PFM:NREP 1 HM:PFM:REP 2->91|PF04456|2.7e-37|46.7|90/90|DUF503| HM:SCP:REP 1->93|1j27A_|1.2e-31|46.7|92/0|d.58.50.1|1/1|Hypothetical protein TT1725| OP:NHOMO 131 OP:NHOMOORG 131 OP:PATTERN -------------------------------------------------------------------- 111------------1111-1-----111111---------------------1----------1-1111------------1-1111------------------------------------------------1111111-11------------------------------------------11--11111111111111111-1111111111111---1111-1--------------------------------------------------------------------------------------------1-1111111111111----1111-1-----11--11111111111-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-111111111--------1-11111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------111-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 78 STR:RPRED 83.9 SQ:SECSTR ##EEEEEEEEE#cccccHHHHHHHHHHHHHHHHHHcccEEEEEEcTTcccEEEEEEEEEEccHHHHHHHHHHHHHHHHHcc############ PSIPRED cEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEEEEcc //