[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49813.1
DDBJ      :             putative CoA-substrate-specific enzyme activase
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  162/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->232 1huxA PDBj 3e-46 49.1 %
:RPS:PDB   62->220 2ahnA PDBj 1e-20 12.7 %
:RPS:PDB   193->247 3c0bA PDBj 8e-05 16.4 %
:RPS:SCOP  1->250 1huxA  c.55.1.5 * 4e-30 42.4 %
:HMM:SCOP  1->252 1huxA_ c.55.1.5 * 4.6e-35 28.7 %
:RPS:PFM   5->248 PF01869 * BcrAD_BadFG 8e-25 43.2 %
:HMM:PFM   5->250 PF01869 * BcrAD_BadFG 6.2e-63 40.7 246/268  
:BLT:SWISS 3->232 HGDC_ACIFE 8e-46 49.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49813.1 GT:GENE ABO49813.1 GT:PRODUCT putative CoA-substrate-specific enzyme activase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1365281..1366048 GB:FROM 1365281 GB:TO 1366048 GB:DIRECTION + GB:PRODUCT putative CoA-substrate-specific enzyme activase GB:NOTE TIGRFAM: putative CoA-substrate-specific enzyme activase PFAM: ATPase, BadF/BadG/BcrA/BcrD type KEGG: mta:Moth_1417 CoA enzyme activase GB:PROTEIN_ID ABO49813.1 GB:DB_XREF GI:134051842 InterPro:IPR002731 InterPro:IPR008275 LENGTH 255 SQ:AASEQ MITAGIDVGSVSTKVVLLIDDEIKYLVRPTGWSPRDAGLHAYQELLDSAGCNNNDVSGVVGTGYGRISLPIIDKAVTEIHCHARGANYLVGQGGLLIDIGGQDSKAILMNERGKVVDFAMNDKCAAGTGRFLQVIAAALGVDVSELADLAENRQPLDINSMCTVFAESEVISLLAKGSDKRDIIAGIHRSVARRVWGMASRFGPAQCVIFTGGVAQNHDVRNRLSQEAGCPVIVPEISQMAGALGAALYARELKK GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 3->232|HGDC_ACIFE|8e-46|49.1|226/260| SEG 91->103|gqggllidiggqd| BL:PDB:NREP 1 BL:PDB:REP 3->232|1huxA|3e-46|49.1|226/259| RP:PDB:NREP 2 RP:PDB:REP 62->220|2ahnA|1e-20|12.7|158/222| RP:PDB:REP 193->247|3c0bA|8e-05|16.4|55/312| RP:PFM:NREP 1 RP:PFM:REP 5->248|PF01869|8e-25|43.2|243/266|BcrAD_BadFG| HM:PFM:NREP 1 HM:PFM:REP 5->250|PF01869|6.2e-63|40.7|246/268|BcrAD_BadFG| RP:SCP:NREP 1 RP:SCP:REP 1->250|1huxA|4e-30|42.4|250/259|c.55.1.5| HM:SCP:REP 1->252|1huxA_|4.6e-35|28.7|251/0|c.55.1.5|1/1|Actin-like ATPase domain| OP:NHOMO 391 OP:NHOMOORG 185 OP:PATTERN -----------------------1--------1112222222223212111112-------------- --1------------------------------------------------------------1-------11111111333-1------1--------------------------------------------------111--------------------------------------------111----------------------------------111111----------------------1----------------------111--------11----------------------------------3433388788882822333411112312-223279444623653333-2--2------------------232-2----------------------------------------------------------------2---------------------------------------------------------------------------------------------------------4---B361-12213111-322313311-----122-12---------1-------11--1--1---------------------------------11-------1------1111111111-11-111-111111111111111-----------------------11-------------------------------------------------------------------------------------------------------------------------1--------------2----------------------------21--12111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 253 STR:RPRED 99.2 SQ:SECSTR ccEEEEEEccccEEEEEEcTTEEEEEEEccccHHHHHHHHHHHHHHHHHTTccccEEEEEEcTTccEEEEEccccccccccTTccccccccEEEEEEccTTcEEEEEEEcTTcccccEEEEEEccccccccEEEcccGGGGccGGGEEEcTTccEEEEccHHHHHccHHHHccTTcccTHTTccccHHHHHHHHHcTTccccTTcTTTccEEEcccEEEEHHHHHHcTTEEEEEGGGTTTHHHHHHHHHHHHH## DISOP:02AL 255-256| PSIPRED cEEEEEEccccEEEEEEEEcccEEEEEEEccccHHHHHHHHHHHHHHHccccHHHHEEEEEcccccHHcccccccEEEEEEHHHHHHHHcccccEEEEEccccEEEEEEccccEEEEEEEccEEHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccEEEEEEHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHccEEEEcccHHHHHHHHHHHHHHHHcc //