[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49827.1
DDBJ      :             response regulator receiver protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  746/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
c.23.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->140 1sd5A PDBj 7e-29 40.7 %
:RPS:PDB   28->138 3cwoX PDBj 3e-19 23.6 %
:RPS:SCOP  5->117 1a0oA  c.23.1.1 * 2e-20 33.6 %
:HMM:SCOP  2->142 1s8nA_ c.23.1.1 * 3.4e-34 39.7 %
:RPS:PFM   7->117 PF00072 * Response_reg 5e-15 42.7 %
:HMM:PFM   7->114 PF00072 * Response_reg 7.6e-29 38.0 108/112  
:BLT:SWISS 6->140 PDTAR_MYCTU 2e-28 40.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49827.1 GT:GENE ABO49827.1 GT:PRODUCT response regulator receiver protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1384525..1385004 GB:FROM 1384525 GB:TO 1385004 GB:DIRECTION + GB:PRODUCT response regulator receiver protein GB:NOTE PFAM: response regulator receiver KEGG: sma:SAV6219 two-component system response regulator GB:PROTEIN_ID ABO49827.1 GB:DB_XREF GI:134051856 InterPro:IPR001789 LENGTH 159 SQ:AASEQ MMHSLRIVLADDEFLTRMDLKEMLAGLGHQVVAEARNGPMALELVEKLRPDMAILDIKMPKMDGIKVAKLIAGQKLCAVLMLSAYSEEELILRAMDAGVTGYITKPVIEKELEPALRIAWARYQDLIRLKDKKVALKETLTQDIQGARSRNNNGARLKK GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 6->140|PDTAR_MYCTU|2e-28|40.7|135/205| BL:PDB:NREP 1 BL:PDB:REP 6->140|1sd5A|7e-29|40.7|135/188| RP:PDB:NREP 1 RP:PDB:REP 28->138|3cwoX|3e-19|23.6|110/236| RP:PFM:NREP 1 RP:PFM:REP 7->117|PF00072|5e-15|42.7|110/111|Response_reg| HM:PFM:NREP 1 HM:PFM:REP 7->114|PF00072|7.6e-29|38.0|108/112|Response_reg| GO:PFM:NREP 3 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| RP:SCP:NREP 1 RP:SCP:REP 5->117|1a0oA|2e-20|33.6|113/128|c.23.1.1| HM:SCP:REP 2->142|1s8nA_|3.4e-34|39.7|141/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 4362 OP:NHOMOORG 792 OP:PATTERN -----------------------21111-113--72--22222F4-1C29657-2-2122-------1 5GM2S4133323-223433-362259333334A9998C78762CD85446437751441144D7IBAPTS43322644-13-5-32221122-1-----2-2-25F3C33------------------13-1--41HHIMH675P8M67D88365342222227729HHM42222222222222332232189DGGGFGEGHGGFFGGECIGGCDFHHADFA975776878Tr53333333333333333311212-33-11-1222222112---11135444445224444444444444444444444445222222223CO8AM6666777777F7884695G9C12E64B5GFGHDB7598B6BD121B737663-----1275522254876----------1-44546263132-2332131122-221223222223225122222222-222-A44-------------------------1-11-211113332355676564433558F5556276893658-1555A7622628B31465555891111111133357B2HFC53E93RJBBB2M9JFDFL7999CA86F78111-22222----------6C143--962979556124555655477764956678--13635------33132434444443344-444444444444434433434344-214443444444444434444344342-334455434554--2344444121156716---------------221221324248BAAB8B8A9777A8B9B---------44556555556855588979775673434--E144564411111-1131--------------------------2-22232333-N1 --------------1------------------------------------------------11-------1--------11--------------1-------1-------------------------------------------------------------------2--11-------5---121--2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 98.7 SQ:SECSTR cEEEcEEEEHHHHHHTcHHHHTTcccTEEEEETccccccTTHHHHHHHccccEEEEcccTTccHHHHHHHHHHcccccEEEEccccTHHHHHHHHHTTccEEEEcHHHHHcTHHHHHHHHHHTGGGEEEEEEEEEcccHHHHHHHHHHHHccTTTTc## DISOP:02AL 1-2,125-160| PSIPRED cccccEEEEEcccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //