[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49835.1
DDBJ      :             Ethanolamine utilization protein EutN/carboxysome structural protein Ccml
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.15
:96 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->93 2qw7H PDBj 1e-13 44.6 %
:RPS:SCOP  3->94 2hd3A1  b.40.15.1 * 3e-18 36.6 %
:RPS:PFM   1->93 PF03319 * EutN_CcmL 2e-10 50.6 %
:HMM:PFM   1->93 PF03319 * EutN_CcmL 3.5e-33 56.6 83/83  
:BLT:SWISS 1->93 CCML_SYNE7 3e-15 49.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49835.1 GT:GENE ABO49835.1 GT:PRODUCT Ethanolamine utilization protein EutN/carboxysome structural protein Ccml GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1392285..1392575 GB:FROM 1392285 GB:TO 1392575 GB:DIRECTION + GB:PRODUCT Ethanolamine utilization protein EutN/carboxysome structural protein Ccml GB:NOTE PFAM: Ethanolamine utilization protein EutN/carboxysome structural protein Ccml KEGG: dsy:DSY0412 hypothetical protein GB:PROTEIN_ID ABO49835.1 GB:DB_XREF GI:134051864 InterPro:IPR004992 LENGTH 96 SQ:AASEQ MILGKVVSSVWATRKETSLTGVKFMIVEILETLSDLEDSDKIDRRKKRKVVVAADLVGAGIGEKVLVSRGSSARQIEGLQETPVDMAIIGIIDEER GT:EXON 1|1-96:0| BL:SWS:NREP 1 BL:SWS:REP 1->93|CCML_SYNE7|3e-15|49.4|83/99| SEG 44->52|rrkkrkvvv| BL:PDB:NREP 1 BL:PDB:REP 1->93|2qw7H|1e-13|44.6|83/98| RP:PFM:NREP 1 RP:PFM:REP 1->93|PF03319|2e-10|50.6|83/83|EutN_CcmL| HM:PFM:NREP 1 HM:PFM:REP 1->93|PF03319|3.5e-33|56.6|83/83|EutN_CcmL| RP:SCP:NREP 1 RP:SCP:REP 3->94|2hd3A1|3e-18|36.6|82/95|b.40.15.1| OP:NHOMO 65 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- --1-----------------------------------------------------------------------------------------------------------------------------------1-----------11111111111------1111--11--------------------------------------------------1---1-----1---------------------1-1---------------------------------------------------------1----------23--1111111111--11-11-2---------22-2----1-1----11--1------------------1---------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------11-1----------------------------------------------------1-----------------1----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 87.5 SQ:SECSTR cEEEEEEEEcccccccGGGTTcEEEEEEEEcTTccEEEEEEE##########EEEcccccTTcEEEEEEGGGGGccTTcTTccccEEEEEEccE## DISOP:02AL 1-1,75-77,96-97| PSIPRED cEEEEEEccEEEEEEcccccccEEEEEEEEcccccccccccccccccccEEEEEEccccccccEEEEEcccccccccccccccEEEEEEEEEEccc //