[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49840.1
DDBJ      :             Propanediol utilization protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  112/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.52.2
:233 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  165->228 1g8jA1  b.52.2.2 * 9e-08 14.1 %
:RPS:PFM   49->128 PF06130 * PduL 8e-21 59.5 %
:RPS:PFM   158->223 PF06130 * PduL 9e-07 32.5 %
:HMM:PFM   48->129 PF06130 * PduL 9.4e-31 50.7 69/71  
:HMM:PFM   157->224 PF06130 * PduL 3.2e-26 42.6 68/71  
:BLT:SWISS 171->233 ATPA_THIFE 1e-04 40.0 %
:REPEAT 2|61->99|113->151

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49840.1 GT:GENE ABO49840.1 GT:PRODUCT Propanediol utilization protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1396706..1397407 GB:FROM 1396706 GB:TO 1397407 GB:DIRECTION + GB:PRODUCT Propanediol utilization protein GB:NOTE PFAM: Propanediol utilization protein KEGG: dsy:DSY2876 hypothetical protein GB:PROTEIN_ID ABO49840.1 GB:DB_XREF GI:134051869 InterPro:IPR008300 LENGTH 233 SQ:AASEQ MTVDKSALINLITKLVLEEIKKSGRSQGKSNASELPKSLTNIDKDKLIPVGISNRHVHLSQEHVEILFGSGAKLTKFKDLSQPGQYACQEMLTLVGPKGVLEKVRVLGPTRKQTQVEVALSDCFKLGIKAPIRDSGDVKGSASLTLVGPQGSITISEGTIIASRHIHMHTSEAAWLSLRDGQRVSVRAHGPRSVTYAEVLVRVSDQFNLEMHVDMDEANAVGLKNGDLVELLG GT:EXON 1|1-233:0| BL:SWS:NREP 1 BL:SWS:REP 171->233|ATPA_THIFE|1e-04|40.0|60/514| NREPEAT 1 REPEAT 2|61->99|113->151| RP:PFM:NREP 2 RP:PFM:REP 49->128|PF06130|8e-21|59.5|79/83|PduL| RP:PFM:REP 158->223|PF06130|9e-07|32.5|66/83|PduL| HM:PFM:NREP 2 HM:PFM:REP 48->129|PF06130|9.4e-31|50.7|69/71|PduL| HM:PFM:REP 157->224|PF06130|3.2e-26|42.6|68/71|PduL| RP:SCP:NREP 1 RP:SCP:REP 165->228|1g8jA1|9e-08|14.1|64/143|b.52.2.2| OP:NHOMO 140 OP:NHOMOORG 112 OP:PATTERN -------------------------------------------------------------------- --1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------11-2---22222211--------------------1-1----------11---------------------------------------------1----------33-11111111212-211111-32---1--3-33-3-----21-----1--1---------------1--1---------------------------------------------------------------------1-------------------------------------------------------------------------------1-----------------------1-1-------11-1------------------------------------------------1-1-------------------1----1---------------1---------1-1111-------11-1--11-----2121----11111111111111111-------1--1-----------------------------------------------------------------------------------------------------------------------------------11111---------------------1111111111-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,22-39| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccccccccccEEEEEEccEEEccHHHHHHHccccccccEEEccccccHHHHccEEEEEccccccccEEEEcccccccEEEEEHHHHHHHcccccccccccccccccEEEEccccEEEEcccEEEEEEEccccHHHHHHHccccccEEEEEEcccccEEEEEEEEEEcccccEEEEEEHHHccccccccccEEEEcc //