[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49848.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:265 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   22->207 PF09608 * Alph_Pro_TM 8e-15 31.3 %
:HMM:PFM   22->208 PF09608 * Alph_Pro_TM 4.4e-17 22.7 181/236  
:BLT:SWISS 64->106 NTF2_EMENI 8e-04 34.9 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49848.1 GT:GENE ABO49848.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1405921..1406718 GB:FROM 1405921 GB:TO 1406718 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49848.1 GB:DB_XREF GI:134051877 LENGTH 265 SQ:AASEQ MRGIVVMMLVSILFPVHALASTITCQLSRNECEVGLDPAKEKIVVFGEGPEDAPIIIKLQGPKRPVLVSLYKDQSFIKFNEIEVQGLPGYYQILTSIPIDKIDSELWYQLGVSSGYEQLKTDAWIRMRQNAEDSYSKHQQDYINLALQQKENDHLYAIRQGVVERNGREYRVEIPLIAGMPIGQIKVTTMTVMDNEILYSQPQLLNIKPASLLSLGSQEVSISAMLVITLFMVPIILLTVAQILEFIEQKREQERRAQLLKQIWQ GT:EXON 1|1-265:0| BL:SWS:NREP 1 BL:SWS:REP 64->106|NTF2_EMENI|8e-04|34.9|43/100| TM:NTM 2 TM:REGION 4->26| TM:REGION 223->245| RP:PFM:NREP 1 RP:PFM:REP 22->207|PF09608|8e-15|31.3|179/236|Alph_Pro_TM| HM:PFM:NREP 1 HM:PFM:REP 22->208|PF09608|4.4e-17|22.7|181/236|Alph_Pro_TM| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,253-256| PSIPRED cHHHHHHHHHHHHHcccccccEEEEEEEccEEEEEccccccEEEEEEEccccccEEEEEEcccccEEEEEEEEEEEEEEEEEEEccccHHHHHHHcccHHHHccHHHHHHHccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccEEEccEEEEEEEEEEEEEccccccccEEEEEEEEEEEccEEEEccccEEEEEEEEEEEcccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //