[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49853.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:85 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->81 2ct6A PDBj 2e-04 23.7 %
:RPS:SCOP  6->76 1h75A  c.47.1.1 * 3e-09 21.7 %
:HMM:SCOP  4->80 1h75A_ c.47.1.1 * 2.8e-08 30.3 %
:HMM:PFM   18->64 PF00462 * Glutaredoxin 4.5e-08 27.7 47/60  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49853.1 GT:GENE ABO49853.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1412219..1412476) GB:FROM 1412219 GB:TO 1412476 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49853.1 GB:DB_XREF GI:134051882 LENGTH 85 SQ:AASEQ MGDYHVTLFVSPWNKTGCDEAKDFLENRGIQYVEKNTQDHGARGELIKKTGGLDTPTLVVNGHTVVGYLPNKWEHLLSEEPLELT GT:EXON 1|1-85:0| RP:PDB:NREP 1 RP:PDB:REP 6->81|2ct6A|2e-04|23.7|76/111| HM:PFM:NREP 1 HM:PFM:REP 18->64|PF00462|4.5e-08|27.7|47/60|Glutaredoxin| RP:SCP:NREP 1 RP:SCP:REP 6->76|1h75A|3e-09|21.7|69/76|c.47.1.1| HM:SCP:REP 4->80|1h75A_|2.8e-08|30.3|76/76|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 95.3 SQ:SECSTR HHHccEEEEEcccHHHHHHHHHHHHHHTTccEEEEETTcHHHHHHHTccccccccccEEEETTEEEEHTTTcHHHHHTccc#### DISOP:02AL 1-2,85-86| PSIPRED cccEEEEEEEEccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccccEEEEccEEEEcccHHHHHHHHHHcccccc //