[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49866.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.18
:92 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->78 2nzcD PDBj 5e-06 26.3 %
:RPS:SCOP  5->78 2nzcA1  d.58.18.14 * 2e-14 25.7 %
:HMM:PFM   61->88 PF03642 * MAP 0.00017 32.1 28/88  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49866.1 GT:GENE ABO49866.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1429618..1429896 GB:FROM 1429618 GB:TO 1429896 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: cac:CAC1326 uncharacterized protein homolog T.maritima (4980675) GB:PROTEIN_ID ABO49866.1 GB:DB_XREF GI:134051895 LENGTH 92 SQ:AASEQ MQQDIYIVGLIVDERGSKAPEVQQIITRYGNSILCRNGIPSPSRERGIITLTMEATPEEYGKMKSELNSIDGVTVESIHFSQQETFQVCKSN GT:EXON 1|1-92:0| BL:PDB:NREP 1 BL:PDB:REP 2->78|2nzcD|5e-06|26.3|76/80| HM:PFM:NREP 1 HM:PFM:REP 61->88|PF03642|0.00017|32.1|28/88|MAP| RP:SCP:NREP 1 RP:SCP:REP 5->78|2nzcA1|2e-14|25.7|74/80|d.58.18.14| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------1---2--1-----------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 82.6 SQ:SECSTR #ccEEEEEEEEEEccHHHHHHHHHHHHHTGGGEEEEEEEE#EGGGTEEEEEEEEEcHHHHHHHHHHHTTcTTEEEEEE############## DISOP:02AL 1-2,92-93| PSIPRED cccEEEEEEEEEEccHHHHHHHHHHHHHHccEEEEEccccccccccEEEEEEEEccHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHccc //