[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49871.1
DDBJ      :             Chromate transporter
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  125/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:184 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   15->179 PF02417 * Chromate_transp 3e-17 33.3 %
:HMM:PFM   13->180 PF02417 * Chromate_transp 4.3e-52 39.9 168/169  
:BLT:SWISS 16->178 YWRA_BACSU 1e-32 38.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49871.1 GT:GENE ABO49871.1 GT:PRODUCT Chromate transporter GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1433633..1434187) GB:FROM 1433633 GB:TO 1434187 GB:DIRECTION - GB:PRODUCT Chromate transporter GB:NOTE PFAM: Chromate transporter KEGG: dsy:DSY1694 hypothetical protein GB:PROTEIN_ID ABO49871.1 GB:DB_XREF GI:134051900 InterPro:IPR003370 LENGTH 184 SQ:AASEQ MAAVITVPFYIAIWQLFVAFGRANIFGFGGGPSVIPLIQQEVVDNYKWLTTEEFTDALAMGNALPGPIATKMAAYVGYKIAGIGGAASALIGTVIPTAVAMLALAGLYFKYKDTPQIGGMLKAVRPVVVVLLIQTVWEMGAKSFPIPTTWLIALVALIALFQFKLHPIILIVSSMLYGLFFLSR GT:EXON 1|1-184:0| BL:SWS:NREP 1 BL:SWS:REP 16->178|YWRA_BACSU|1e-32|38.7|163/178| TM:NTM 4 TM:REGION 2->24| TM:REGION 84->106| TM:REGION 119->141| TM:REGION 153->175| SEG 73->92|aayvgykiagiggaasalig| RP:PFM:NREP 1 RP:PFM:REP 15->179|PF02417|3e-17|33.3|165/170|Chromate_transp| HM:PFM:NREP 1 HM:PFM:REP 13->180|PF02417|4.3e-52|39.9|168/169|Chromate_transp| GO:PFM:NREP 2 GO:PFM GO:0015109|"GO:chromate transmembrane transporter activity"|PF02417|IPR003370| GO:PFM GO:0015703|"GO:chromate transport"|PF02417|IPR003370| OP:NHOMO 186 OP:NHOMOORG 125 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------223212-1-----1----1---------------------------------------1111221-111------12-11111------------------1---2---------------222222----22-4--------34-------------------------------------------------------------------------------------------25--2222222222-1--111121-1113---2211--121-22--112------------1----------------------1------------------------------11------1--------------1-----------------------------------------1---------------------------1-2---111--111-1--11---1-------------11------1-----1---1-22-2-------1---------------------------------------1--------1----------------1-------------------------------------------11------------------------------------------------------------2----------------22222-1---1-----1-1-21111------------------------------------------------------------1---------------------------1-1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,5-5| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc //