[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49881.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->172 3do9C PDBj 3e-14 28.5 %
:RPS:PDB   6->176 3do9B PDBj 3e-06 27.3 %
:RPS:PFM   8->102 PF08864 * UPF0302 4e-11 31.6 %
:HMM:PFM   8->110 PF08864 * UPF0302 7.2e-34 36.0 100/106  
:HMM:PFM   144->173 PF08858 * IDEAL 7.7e-09 43.3 30/37  
:BLT:SWISS 8->176 Y2074_BACA2 4e-14 28.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49881.1 GT:GENE ABO49881.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1443596..1444141) GB:FROM 1443596 GB:TO 1444141 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: bha:BH3876 hypothetical protein GB:PROTEIN_ID ABO49881.1 GB:DB_XREF GI:134051910 LENGTH 181 SQ:AASEQ MLANNLAEKKELIVWFLRTNRLKKPEAARILEFIKDNKSLLSRIEFTNKLSDKKDALLVSAVYTNTFPFDFRLNNNHYGSVDEALYQLKTNPPHKLFMWLSFASPPSCALCSHRNNKQVRPLPNPASMAHKLLVEAVKTVNRKEAQKRTLLLEIDQSLDEKNIHKFQRLTGELQKLICENN GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 8->176|Y2074_BACA2|4e-14|28.0|164/179| BL:PDB:NREP 1 BL:PDB:REP 8->172|3do9C|3e-14|28.5|158/164| RP:PDB:NREP 1 RP:PDB:REP 6->176|3do9B|3e-06|27.3|165/177| RP:PFM:NREP 1 RP:PFM:REP 8->102|PF08864|4e-11|31.6|95/106|UPF0302| HM:PFM:NREP 2 HM:PFM:REP 8->110|PF08864|7.2e-34|36.0|100/106|UPF0302| HM:PFM:REP 144->173|PF08858|7.7e-09|43.3|30/37|IDEAL| OP:NHOMO 41 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111221---111111------------------------------------------------------------------------------------------------------------------------1-------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 94.5 SQ:SECSTR #####HHHHHHHHHHHHHHcccccTHHHHHHHHHHHcTTTTTTEEEcccGGGcTTEEEEEccccccccEEEEccccEEccHHHHHHHHHHcccccEEEEEEccccTcHHHHHHccccTTccccccTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHH##### DISOP:02AL 1-4,6-6,179-182| PSIPRED ccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHEEccEEEccHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccc //