[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49887.1
DDBJ      :             RNA polymerase, sigma-24 subunit, ECF subfamily
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  279/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.177.1a.4.13
:179 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->163 1or7A PDBj 1e-07 28.5 %
:RPS:PDB   16->169 3dxjF PDBj 7e-18 10.4 %
:RPS:SCOP  15->82 1h3lA  a.177.1.1 * 2e-13 23.5 %
:RPS:SCOP  117->170 1ku3A  a.4.13.2 * 2e-08 18.5 %
:HMM:SCOP  8->82 1h3lA_ a.177.1.1 * 1.5e-18 32.0 %
:HMM:SCOP  83->173 1iw7F2 a.4.13.2 * 3.4e-14 31.9 %
:RPS:PFM   19->85 PF04542 * Sigma70_r2 6e-06 39.4 %
:RPS:PFM   117->167 PF08281 * Sigma70_r4_2 2e-04 43.1 %
:HMM:PFM   120->169 PF04545 * Sigma70_r4 2.6e-15 36.0 50/50  
:HMM:PFM   19->85 PF04542 * Sigma70_r2 1.9e-15 35.8 67/71  
:BLT:SWISS 15->173 YLAC_BACSU 1e-17 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49887.1 GT:GENE ABO49887.1 GT:PRODUCT RNA polymerase, sigma-24 subunit, ECF subfamily GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1449783..1450322 GB:FROM 1449783 GB:TO 1450322 GB:DIRECTION + GB:PRODUCT RNA polymerase, sigma-24 subunit, ECF subfamily GB:NOTE PFAM: sigma-70 region 2 domain protein; sigma-70 region 4 domain protein; Sigma-70, region 4 type 2 KEGG: sth:STH2528 RNA polymerase ECF-type sigma factor GB:PROTEIN_ID ABO49887.1 GB:DB_XREF GI:134051916 InterPro:IPR007627 InterPro:IPR007630 InterPro:IPR013249 LENGTH 179 SQ:AASEQ MTPATKNRHPDGDLSFEELYDRYFEPVNRYLRYRMDSAWDADDLTTTVFMKALENFSKYRAEGPFSGWLFRIAHNVYVDYIRGRREYATNDVMLELAAGSDDGPEETVLQGEEITRLRQLLKGLSPDYRDVVSLRYAAELRFVQIAEVLGKSESAVRMLHHRAIKQLRQRYVREGGSAR GT:EXON 1|1-179:0| BL:SWS:NREP 1 BL:SWS:REP 15->173|YLAC_BACSU|1e-17|30.8|159/173| BL:PDB:NREP 1 BL:PDB:REP 40->163|1or7A|1e-07|28.5|123/181| RP:PDB:NREP 1 RP:PDB:REP 16->169|3dxjF|7e-18|10.4|154/349| RP:PFM:NREP 2 RP:PFM:REP 19->85|PF04542|6e-06|39.4|66/70|Sigma70_r2| RP:PFM:REP 117->167|PF08281|2e-04|43.1|51/54|Sigma70_r4_2| HM:PFM:NREP 2 HM:PFM:REP 120->169|PF04545|2.6e-15|36.0|50/50|Sigma70_r4| HM:PFM:REP 19->85|PF04542|1.9e-15|35.8|67/71|Sigma70_r2| GO:PFM:NREP 10 GO:PFM GO:0003677|"GO:DNA binding"|PF04542|IPR007627| GO:PFM GO:0003700|"GO:transcription factor activity"|PF04542|IPR007627| GO:PFM GO:0006352|"GO:transcription initiation"|PF04542|IPR007627| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF04542|IPR007627| GO:PFM GO:0016987|"GO:sigma factor activity"|PF04542|IPR007627| GO:PFM GO:0003677|"GO:DNA binding"|PF08281|IPR013249| GO:PFM GO:0003700|"GO:transcription factor activity"|PF08281|IPR013249| GO:PFM GO:0006352|"GO:transcription initiation"|PF08281|IPR013249| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08281|IPR013249| GO:PFM GO:0016987|"GO:sigma factor activity"|PF08281|IPR013249| RP:SCP:NREP 2 RP:SCP:REP 15->82|1h3lA|2e-13|23.5|68/75|a.177.1.1| RP:SCP:REP 117->170|1ku3A|2e-08|18.5|54/61|a.4.13.2| HM:SCP:REP 8->82|1h3lA_|1.5e-18|32.0|75/75|a.177.1.1|1/1|Sigma2 domain of RNA polymerase sigma factors| HM:SCP:REP 83->173|1iw7F2|3.4e-14|31.9|91/105|a.4.13.2|1/1|Sigma3 and sigma4 domains of RNA polymerase sigma factors| OP:NHOMO 504 OP:NHOMOORG 281 OP:PATTERN -------------------------------------------------------------------- 45D-2321222111-1111-121112111111221222111-1121--1---121--1--1121223343----------112-----3343-233---11212334514---------------11-1-11--2142264112511221111--11------1121111--------------2----1-21411111-23----11-123345--1122122----1--P2--------------------------------------------------1-1-------------------------------------1321-11111111-11133----412--61-2367724512-21-311--5-21----------11221-1-11-----------------------1---------------1-1---------------------------------------------------------1-1-------------1111----111111----1----------11--11-----12-1------------1---3---11--11----21----1-1--11-1-3--------------------------------22-1-----------------------------------------1---1---1---11---1--1-1111111--------------------------------1-----------------1-----------1------1--------------------1-22221122111111111------------------------11--1-----------1---1211------------------------------------11----1----5- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 154 STR:RPRED 86.0 SQ:SECSTR ###############HHHHHHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHHHHHTcccccTTcccTTcccccGGGTccccccccHHH########## DISOP:02AL 1-13,173-180| PSIPRED ccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccc //