[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49889.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:784 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:PFM   192->240 PF07090 * DUF1355 8.3e-06 30.6 49/177  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49889.1 GT:GENE ABO49889.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1451793..1454147 GB:FROM 1451793 GB:TO 1454147 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE KEGG: swo:Swol_1724 hypothetical protein GB:PROTEIN_ID ABO49889.1 GB:DB_XREF GI:134051918 LENGTH 784 SQ:AASEQ MNTKRKRQGEKYLFSGLLLTLVMLMFLITPNPVLASDTGVIRLAVQPGLSGIYKLDFPAGLVISVSNQGKACQGVLVVEPDVKSRNNQQNRNEDIQYRKTIDMPTKSLVTTNLMVPSELLNKGAQVVLLVNEQPVAVTPIQGTAVNGGLIALSLGEKPLNGGFPAWLDQTFGGQTAIKYMEPTYLPDDPIELLQANIIIVDDVALRELNKKQLTTLKDWVSLGGMLLLSGGAGSSSGGSLTDISPVVAEKQEVIPADLGGLQEVKGNMTISSGPLTEGEILAQVKDTILIAARDFGKGRVIFSGIPLENLTSESNRVWSLIFGRADSPSKADTKMQMTWDKRSLDNNLLHASTYLPQIKTPPVPQVALAWVVYVLVIGPVLYLVLKRYDRRDCMWWIIPTCAMITTGAVYFMSPAQKIHAPISQTLSVLEILDNERAELNATASFISPYGGTLRVEGARGSVVWPANFNQTNKMPIIHYDRTTTPSLSFPDVEYWSMRQASATAFKKNVGSIQGNLTLEDGYITGKIQNNTDMELKNCKILLGGRPLVLKNIPAGGYVTVKQSLAKWPESLGPNEFRDLLVPPVNPGQSDNYIRERQMVDAVLEPSEFGQSNQPVFYGWSDDSQEIFKILSDRGNVRNYNLTLVTQRLNLEIADGQVIKLPSGMYRPKIIETRGAFNETPLGFTLYEGKIVLSINLARPLKSQKIKVETVEIPAQTNKNLVLKIYDWQNKKWLNVPVGGLKLKQDQLKQYGATGELRIQIEKVSNLGQTDRVDLPAVSVKGGKS GT:EXON 1|1-784:0| TM:NTM 3 TM:REGION 20->42| TM:REGION 364->385| TM:REGION 393->415| SEG 13->27|lfsgllltlvmlmfl| SEG 221->240|slggmlllsggagsssggsl| HM:PFM:NREP 1 HM:PFM:REP 192->240|PF07090|8.3e-06|30.6|49/177|DUF1355| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------2------------------------------------------------------------------------------------------------------------------------------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 12.1 SQ:SECSTR ########################################################################################################################################################################################################################################################################################################################################################################################TccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccTTcccccEEEEEEEEEEEccccccccEEEEEcccEEEEcccccHH######################################################################################################################################################################################################################################################################################################################### DISOP:02AL 1-9,82-94,782-785| PSIPRED cccHHHHccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccccEEEEccccEEEEEEccccccEEEEEEEccccccccccccccccEEEEEEcccccccEEEEcccccHHHHccccEEEEEEcccEEEEEEEEEEEccccEEEEEEEcccccccccccccccccccccEEEcccccccccHHHcccccEEEEEccHHHcccHHHHHHHHHHHHcccEEEEEccccHHHcccHHHHHHHHccccccccHHccccccEEEEEEEEcccccccEEEEEcccccEEEEccccccEEEEEEccccccHHHHHHHHHHcccccccccccccEEEEEEcccHHHHHHHHHHHcccccccccccccEEEEEEEEEEEHHHHHHHHHHHccccccEEEcccccEEEccEEEEEcHHHccccEEEEEEEEEEEcccccHHHHEEEEEEcccccEEEEEEcccEEEEEEEEccccccccEEEEccccccEEEcccEEEEHHHHHHHHEEEccccEEEEEEEEccEEEEEEEcccccEEEEEEEEEcccEEEEEEcccccHHHHHHHHHHcHHHccHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccEEEEEEEccccEEEEEEEccccccccEEEEEEEEEEEEEccccEEEEcccccccEEEEEcccccccccEEEEEccEEEEEEEEcccccccEEEEEEEEcccccccEEEEEEEEccccEEEEcccccEEEcHHHHHHcccccEEEEEEEEEccccccccccccEEEEccccc //