[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49907.1
DDBJ      :             extracellular solute-binding protein, family 3
Swiss-Prot:             

Homologs  Archaea  32/68 : Bacteria  711/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:277 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->274 3hv1B PDBj 5e-35 38.0 %
:RPS:PDB   54->274 3delB PDBj 8e-47 21.8 %
:RPS:SCOP  43->274 1xt8A1  c.94.1.1 * 5e-48 25.5 %
:HMM:SCOP  1->275 2a5sA1 c.94.1.1 * 7.2e-75 42.3 %
:RPS:PFM   62->270 PF00497 * SBP_bac_3 5e-38 40.4 %
:HMM:PFM   54->271 PF00497 * SBP_bac_3 3.7e-71 38.5 218/225  
:BLT:SWISS 41->275 FLIY_ECOLI 4e-47 35.9 %
:PROS 76->89|PS01039|SBP_BACTERIAL_3
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49907.1 GT:GENE ABO49907.1 GT:PRODUCT extracellular solute-binding protein, family 3 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1480046..1480879) GB:FROM 1480046 GB:TO 1480879 GB:DIRECTION - GB:PRODUCT extracellular solute-binding protein, family 3 GB:NOTE PFAM: extracellular solute-binding protein, family 3 SMART: ionotropic glutamate receptor KEGG: ctc:CTC00557 cystine/glutamine-binding periplasmic protein GB:PROTEIN_ID ABO49907.1 GB:DB_XREF GI:134051936 InterPro:IPR001320 InterPro:IPR001638 LENGTH 277 SQ:AASEQ MKKRGLWFLVLVLTLALVTMGCGGGEKEKQAANQEPAKQTEKNTLDQIKEKGVIVAGLDDTFAPMGYRDESNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMTVTEERKKSINFSVPYVGDGQIMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGIKEVKLYKTYPEAFTDLQIGRIPVVVCDRITASHYISKRADTYEIVGEKITDEPLAIGLRKSDPELKEAIDNVLNEMKKDGTLTKISMKWFNRDITVK GT:EXON 1|1-277:0| BL:SWS:NREP 1 BL:SWS:REP 41->275|FLIY_ECOLI|4e-47|35.9|234/266| PROS 76->89|PS01039|SBP_BACTERIAL_3|PDOC00798| TM:NTM 1 TM:REGION 5->21| SEG 9->19|lvlvltlalvt| BL:PDB:NREP 1 BL:PDB:REP 40->274|3hv1B|5e-35|38.0|229/249| RP:PDB:NREP 1 RP:PDB:REP 54->274|3delB|8e-47|21.8|220/232| RP:PFM:NREP 1 RP:PFM:REP 62->270|PF00497|5e-38|40.4|208/222|SBP_bac_3| HM:PFM:NREP 1 HM:PFM:REP 54->271|PF00497|3.7e-71|38.5|218/225|SBP_bac_3| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00497|IPR001638| GO:PFM GO:0006810|"GO:transport"|PF00497|IPR001638| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF00497|IPR001638| RP:SCP:NREP 1 RP:SCP:REP 43->274|1xt8A1|5e-48|25.5|231/248|c.94.1.1| HM:SCP:REP 1->275|2a5sA1|7.2e-75|42.3|253/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 3761 OP:NHOMOORG 748 OP:PATTERN 11---1----------1-2222212--11-1111----7679311113-11-1----1------1--- ----432133324241111-18112B111111A66636AB14224131222-645223--112-7559472644464421321--------------------------111111111111111-----1--2-1-111221113-33553343222-------211336-------------4441133--263444447544554453332674453225544444443A4222222222222222222225647988755666668836468433388865544A9767978877784554455554554488B9988881365B453555523245332333133213233177-5121-2111111281--11114322312E6611121-115654526656L---A--91A6B11SKKHHFGJGKDGF6---13832333351111111132211134----------111111111111111--1-2-----5B99BOQQRRP99AA9IIKRBBBB8CPIS7B97-1CCD43B54C6E9JF126---1853322222---11-14B2777B44A77746155-411132-21--4-6445444443122222222-22----776-3-1---8-2111--21111311211-2-4-1-1------99FG7A97776775777-7787777677777677669HLFEC553C8798A9999A99998F766767741989999998999--31111116676--36833343522222222144444-53652-DCCD9IFK88A772DAB---------14449444446554411--------------17----11--------213-------------------------121-124212--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------2-----------1--1-----------1--2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 87.4 SQ:SECSTR ###################################EEccTTcccccccTTcEEEEEEEccccTTTcEEcTTccEEcHHHHHHHHHHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEEEEEccccccccGGGcccEEEETTcHHHHHHHHcTTccGEEEEccHHHHHHHHHTTcccEEEEcHHHHHHHGGGcEEEEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHHHHHTTGGGccHH DISOP:02AL 1-1,29-41,277-278| PSIPRED ccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHcccEEEEEEcccccEEEEcccccEEEEHHHHHHHHHHHHccEEEEEEccHHHHHHHHHcccccEEEccccccHHHHHHHHHcccEEEccEEEEEEccccccccHHHHcccEEEEEcccHHHHHHHHHcccccEEEEccHHHHHHHHHcccccEEEEcHHHHHHHHHHccccEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccc //