[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49911.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   115->135 PF07125 * DUF1378 0.00032 52.4 21/59  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49911.1 GT:GENE ABO49911.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1485457..1485981 GB:FROM 1485457 GB:TO 1485981 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49911.1 GB:DB_XREF GI:134051940 LENGTH 174 SQ:AASEQ MKGTISEIWEVVDQMVEENIDTFLEDKVEEDIVEDNLKDIEEYDDDIGIDFNEIEKDEKFKTFDPVEENKEEWLQEFERILADYKLQPTYKIETIKRNSSSEALKAVLLVGGGIIILGLVAGGFMVNRNYCRRAVVQTLPVKEEPAVKEPVIETISAQPFPKRERMPWPFFYFR GT:EXON 1|1-174:0| TM:NTM 1 TM:REGION 103->125| SEG 39->50|dieeydddigid| SEG 103->123|alkavllvgggiiilglvagg| HM:PFM:NREP 1 HM:PFM:REP 115->135|PF07125|0.00032|52.4|21/59|DUF1378| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccc //