[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49920.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:254 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   103->152 1dqaD PDBj 6e-04 26.8 %
:HMM:PFM   114->160 PF00713 * Hirudin 0.001 26.7 45/64  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49920.1 GT:GENE ABO49920.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1497675..1498439) GB:FROM 1497675 GB:TO 1498439 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE KEGG: bce:BC2426 hypothetical protein GB:PROTEIN_ID ABO49920.1 GB:DB_XREF GI:134051949 LENGTH 254 SQ:AASEQ MSYCCPPHKPSKKIVTGGTQPTCVSTSVPIEALYGPLTSKIPVVVAETTLQIDVNSTITLPERALEIKGCKKRVKVTQCMLLQAPGQTSGPITLCVKGFIRNNIDYSNRLCSNTEGVCGDIRHCTVDVPFSCNTPIEINGTYPLPPMPNTSEEFEYFRREKLKGHGFAEKDELLSGDLSEFNQVSEEFYNELPFCELVSARIVQYDEYLNRRHPKGVTLPFEEKEFRQFEQKMVLYLTLKILQKRQVQIPPSIY GT:EXON 1|1-254:0| SEG 221->232|feekefrqfeqk| RP:PDB:NREP 1 RP:PDB:REP 103->152|1dqaD|6e-04|26.8|41/396| HM:PFM:NREP 1 HM:PFM:REP 114->160|PF00713|0.001|26.7|45/64|Hirudin| OP:NHOMO 32 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111---1--------13---2---------2--------------------------------------------------------------------------------------------11--1111111-1---11------2-----1----4--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 31.1 SQ:SECSTR ###########################################################ccGGGHHcccHHHHHHHHHHHHHTTcccTTc#####GGGcccTcccHHTTTcccccc########cccccEEEEEEEEETTEEEEEEEE#ccc###################################################################################################### DISOP:02AL 1-4,252-253| PSIPRED ccccccccccHHHEEEccccccccccccccEEccccEEEEEEEEEEccEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEcccccccccEEEEEEEEEEEEEccEEEEEEEEcccccccccccccccHHHHccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEEEccEEcccccccccccccccHHHHEEEEEEEEEEEEEEEEEEEEccccccc //