[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49925.1
DDBJ      :             NAD-dependent epimerase/dehydratase
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  570/915 : Eukaryota  138/199 : Viruses  3/175   --->[See Alignment]
c.2.1
:320 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->310 1bsvA PDBj e-108 59.7 %
:RPS:PDB   6->307 1e7rA PDBj 5e-42 59.3 %
:RPS:SCOP  6->307 1bsvA  c.2.1.2 * 7e-46 59.9 %
:HMM:SCOP  1->307 2c5aA1 c.2.1.2 * 2.7e-73 34.1 %
:RPS:PFM   7->234 PF01370 * Epimerase 1e-22 35.2 %
:HMM:PFM   7->238 PF01370 * Epimerase 3.9e-77 42.1 221/238  
:BLT:SWISS 1->313 FCL2_ARATH e-120 66.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49925.1 GT:GENE ABO49925.1 GT:PRODUCT NAD-dependent epimerase/dehydratase GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1503613..1504575 GB:FROM 1503613 GB:TO 1504575 GB:DIRECTION + GB:PRODUCT NAD-dependent epimerase/dehydratase GB:NOTE PFAM: NAD-dependent epimerase/dehydratase KEGG: mba:Mbar_A0035 GDP-fucose synthetase GB:PROTEIN_ID ABO49925.1 GB:DB_XREF GI:134051954 InterPro:IPR001509 LENGTH 320 SQ:AASEQ MDKHSKIYIAGHRGLVGSAIKRRLEQLGYTNLVYRSSKELELRNQKAVEEFFCAEKPAYVFLVAAKVGGILANNTYPAEFIYDNLSIQTNVIHTSYLHSVKKLLFLGSSCIYPKLTPQPMKEEYLLSGKLEPTNEPYAIAKIAGIKMCQAYNRQYGTNFISVMPTNLYGPNDNFDLENSHVLPALIRKFHEAKTKIQPAVTVWGTGTPKREFLHVDDLADACVFLMEHYQDSEIINIGTGQDLTIKELAELVKAKVGYQGEIVYDNTKPDGTPKKLLDVSKLKSMGWQAQIPLKEGLVGTYEWYQKNVSRNLQQIQDVYQ GT:EXON 1|1-320:0| BL:SWS:NREP 1 BL:SWS:REP 1->313|FCL2_ARATH|e-120|66.1|313/328| BL:PDB:NREP 1 BL:PDB:REP 6->310|1bsvA|e-108|59.7|305/317| RP:PDB:NREP 1 RP:PDB:REP 6->307|1e7rA|5e-42|59.3|302/314| RP:PFM:NREP 1 RP:PFM:REP 7->234|PF01370|1e-22|35.2|213/232|Epimerase| HM:PFM:NREP 1 HM:PFM:REP 7->238|PF01370|3.9e-77|42.1|221/238|Epimerase| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF01370|IPR001509| GO:PFM GO:0044237|"GO:cellular metabolic process"|PF01370|IPR001509| GO:PFM GO:0050662|"GO:coenzyme binding"|PF01370|IPR001509| RP:SCP:NREP 1 RP:SCP:REP 6->307|1bsvA|7e-46|59.9|302/317|c.2.1.2| HM:SCP:REP 1->307|2c5aA1|2.7e-73|34.1|299/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 2140 OP:NHOMOORG 776 OP:PATTERN 111-1-32232213421312123152224522255213132221534545574133322231213-12 54823112111-1-1-111-11--21222222-1-1-113243411---2213--1--112121423212-111111-1---5355433363-5111--2-433436464--------------1223-243335199956---436555775321123-24235265573232112443-1323211-13-322222253342423532644322234512131---2--572111111111111113---13-1-21-1---231111112--21----------------------------------------------32-6255555653533-443111114--4--313353562332111221-2752125-----1263312112-3523332133322-5539545615212333673586252-211212524522-111111111----424-----------------------------11-11--22-22111142----3343------3253-2212---31----2221--1-1-1-2----------2-211214135546544456434348-64343365611-1-221252121111111--31-----2-3111--2--1----1------1-------4212------121--11222121123--2222121111221112112--1-1---1111111111111111-22-22211-1-11111111-1----55555----2-311-----------------------11--11212111-1112-1-21--------1-------------1232111111122-21-45443355------------------------------------1112512211444 1122114-311-454211---1----1-------------------11112223111-2--11------1----1------11111-1-1631122----11-334-2846254443223-233341417E3-343333-332321233-31-3132332343421-224244328334*97625DDFG1GG77A7885 -----------------------2--------------------------------------------------------------------------------------------------------------------------------------------------11--- STR:NPRED 320 STR:RPRED 100.0 SQ:SECSTR cccccEEEEETTTcHHHHHHHHHHTTcTTEEEEcccTTTccTTcHHHHHHHHHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTccEEEEEccGGGccTTccccccGGGTTcccccGGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTccccTTcccHHHHHHHHHHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHHccHHHHHHTccccccEEHHHHHHHHHHHHTcccEEEEETTccccccccccccHHHHHTTccccccHHHHHHHHHHHHHHTHHHHHHTTcccGG DISOP:02AL 1-3,319-321| PSIPRED cccccEEEEEccccHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHccccEEEEcccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEccccEEEEEEHHHHHHHHHHHHHccccccEEEEcccccEEHHHHHHHHHHHHcccccEEEcccccccccEEcccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccc //