[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49942.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49942.1 GT:GENE ABO49942.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1527992..1528414 GB:FROM 1527992 GB:TO 1528414 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49942.1 GB:DB_XREF GI:134051971 LENGTH 140 SQ:AASEQ MGDVRIYTEVLNTINKSKVKRIICPNPNFPPKAVGEKSYVLLKNVNLDFTGPEPKVIFDYYVSLEYQFEFGYDYCIGRGNDFITLPEGFHLCSYPVDPVLTYSAACEEFELVDGVIKAIIRMDLSVVLCQYQTINVKPSI GT:EXON 1|1-140:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,139-141| PSIPRED ccccEEEHHHHHcccHHHEEEEEccccccccccccccEEEEEEEccccccccccEEEEEEEEEEEEEEEEccEEEEEccccEEEcccccEEEccccccEEEEccccHHHHHHHHHHHHHHHccEEEEEEEEEEEEEcccc //