[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49951.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->61 PF06277 * EutA 0.00076 31.2 32/473  
:BLT:SWISS 1->89 EF2_PYRAB 3e-04 33.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49951.1 GT:GENE ABO49951.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1539918..1540193) GB:FROM 1539918 GB:TO 1540193 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49951.1 GB:DB_XREF GI:134051980 LENGTH 91 SQ:AASEQ MNIKTIDQQYIYWRYKSQWCVAKVQVSASADKVFLYIWQLDGTFVCMTAGKQPETVLQSQGFKLWLREGSPNLKEILEEKVKTKPEQIEFF GT:EXON 1|1-91:0| BL:SWS:NREP 1 BL:SWS:REP 1->89|EF2_PYRAB|3e-04|33.0|88/100| HM:PFM:NREP 1 HM:PFM:REP 30->61|PF06277|0.00076|31.2|32/473|EutA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,85-87| PSIPRED cccEEEEEEEEEEEEcccEEEEEEEEEccccEEEEEEEEEccEEEEEEccccHHHHHHcccEEEEEEcccccHHHHHHHHHHccHHHEEcc //