[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49955.1
DDBJ      :             protein of unknown function DUF81
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:426 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   113->349 PF01925 * TauE 8e-12 29.2 %
:HMM:PFM   79->350 PF01925 * TauE 4.7e-35 27.6 225/239  
:BLT:SWISS 290->383 ABCG1_MOUSE 7e-04 35.1 %
:TM
:REPEAT 2|97->187|266->353
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49955.1 GT:GENE ABO49955.1 GT:PRODUCT protein of unknown function DUF81 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1544973..1546253 GB:FROM 1544973 GB:TO 1546253 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF81 GB:NOTE PFAM: protein of unknown function DUF81 KEGG: dvl:Dvul_2833 protein of unknown function DUF81 GB:PROTEIN_ID ABO49955.1 GB:DB_XREF GI:134051984 InterPro:IPR002781 LENGTH 426 SQ:AASEQ MRGLYEALMSASRAHAKWELEMSNNIIRNRKHLLVLALMMLPLVIPAIGHAADLPGFIGGKSAYGPSHYNPMMFYGSMAVGICAGLITGCIGAGGGFVITPALMSLGVKGILAVGTDQFHIFAKAIMGTVIHKKLGNVNVALAIAFLVGSGIGVTAGGTLNRALFNMNPVLSDFIISLVYVVMLGFLGFYSMYDFIKNKNTSGDAHGGPEGMTKLAQKLQGVNIAPMVKFDEDIVPGGRKISGWFVAFCGAVVGFAAAIMGVGGGFLTFPMFVYGLGVSSFTTVGTDILQIIFTAGYSSIAQYAVYGYIFYTLAMGMLVGSLLGIQIGAATTKVVSGIYIRAFYAIAIMAGFVNRAFALPEKMAQMGYISIAKENGVLFSNIGAWVFFGLILIFAVWIILSFIRGLPILRAETAEASMASGKGVSH GT:EXON 1|1-426:0| BL:SWS:NREP 1 BL:SWS:REP 290->383|ABCG1_MOUSE|7e-04|35.1|94/666| TM:NTM 9 TM:REGION 32->54| TM:REGION 82->104| TM:REGION 136->158| TM:REGION 169->191| TM:REGION 241->263| TM:REGION 273->295| TM:REGION 305->327| TM:REGION 332->354| TM:REGION 380->402| NREPEAT 1 REPEAT 2|97->187|266->353| SEG 33->47|llvlalmmlplvipa| SEG 81->96|gicaglitgcigaggg| SEG 243->258|gwfvafcgavvgfaaa| RP:PFM:NREP 1 RP:PFM:REP 113->349|PF01925|8e-12|29.2|195/237|TauE| HM:PFM:NREP 1 HM:PFM:REP 79->350|PF01925|4.7e-35|27.6|225/239|TauE| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF01925|IPR002781| OP:NHOMO 43 OP:NHOMOORG 27 OP:PATTERN -----------------------2142---1------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-114--------------2----------------------------------------------------------------11-----1---------------1-----------------------------------------------------------------------------------------1--------------------11--2-222222-----------------1-------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,6-7,198-213,410-420,422-427| PSIPRED ccHHHHHHHHHccHHcEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHccEEcccccEEEccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEccHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //