[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49964.1
DDBJ      :             beta-lactamase domain protein
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  119/915 : Eukaryota  41/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:276 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->258 2p4zB PDBj 9e-40 35.0 %
:RPS:PDB   25->251 3bv6A PDBj 6e-13 12.0 %
:RPS:SCOP  3->244 1smlA  d.157.1.1 * 5e-11 15.0 %
:HMM:SCOP  19->276 1xtoA_ d.157.1.6 * 1.5e-36 29.6 %
:RPS:PFM   23->91 PF00753 * Lactamase_B 9e-09 42.6 %
:HMM:PFM   24->195 PF00753 * Lactamase_B 6.1e-13 19.7 142/194  
:HMM:PFM   223->257 PF08901 * DUF1847 0.00068 22.9 35/157  
:BLT:SWISS 5->276 Y448_METJA 5e-37 39.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49964.1 GT:GENE ABO49964.1 GT:PRODUCT beta-lactamase domain protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1555521..1556351 GB:FROM 1555521 GB:TO 1556351 GB:DIRECTION + GB:PRODUCT beta-lactamase domain protein GB:NOTE PFAM: beta-lactamase domain protein KEGG: mta:Moth_1430 beta-lactamase-like GB:PROTEIN_ID ABO49964.1 GB:DB_XREF GI:134051993 InterPro:IPR001279 LENGTH 276 SQ:AASEQ MQLKITVIAENDVKKRYLLAEHGLSLLVKIGNYQLLFDTGQGLAIESNVRAMQLDLTKINAMALSHGHYDHTGGLKRALALSGPKPIYAHPGVFDDKYSTNREGEHKSVGIPFSKKELEMLGAEFHLQSTPIHLGSDIILSGQIPRTTDFEEINDRFVIKKDGKYEVDPLLDDQALFIKTAKGVVVIVGCSHSGIINILKYARQLTGEEDIYAVVGGTHLVEANEERLHRTIEELRAMKVEKLAVSHCTGFQAQVKLKETFGHGFVLNNVGNSICI GT:EXON 1|1-276:0| BL:SWS:NREP 1 BL:SWS:REP 5->276|Y448_METJA|5e-37|39.0|251/256| BL:PDB:NREP 1 BL:PDB:REP 3->258|2p4zB|9e-40|35.0|254/276| RP:PDB:NREP 1 RP:PDB:REP 25->251|3bv6A|6e-13|12.0|208/353| RP:PFM:NREP 1 RP:PFM:REP 23->91|PF00753|9e-09|42.6|68/171|Lactamase_B| HM:PFM:NREP 2 HM:PFM:REP 24->195|PF00753|6.1e-13|19.7|142/194|Lactamase_B| HM:PFM:REP 223->257|PF08901|0.00068|22.9|35/157|DUF1847| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 3->244|1smlA|5e-11|15.0|227/266|d.157.1.1| HM:SCP:REP 19->276|1xtoA_|1.5e-36|29.6|223/0|d.157.1.6|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 229 OP:NHOMOORG 193 OP:PATTERN ------1--------12-----11-----1----112111111221111-32111122211---1--- --1----------------------1--------------------------------------------------------------111----------------------------------11-11111-------1-----------------------------------------------11------------------------------------------------------------------------------------1------------------------------------------------11-1-2222323131-122111111-------11112-11--11111----1-----------11-1--------------------1111111---------------------------------------------------------------------------------1----------------------------------------------------1----1---------------23-221--11----111111113------11----------------------1----1-3---------------1-----11---1---------------------------------------------------1---1111-1-1111111111-11---------1-----------------------------------------------------------------------------------1----------1---------------------------------------------------------------111111111--- ---------------11--111121111111111111111-11111-----121------------------------------------111111---1----------------------------------------------------------------------------11--------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 261 STR:RPRED 94.6 SQ:SECSTR ccEEEEEEETTEEEEEEEcEEEEEcccccTTcHHHHHHccccccccccccccGGGcccccEEEcccccGGGccHHHHHHHccTTcEEEEcHHHHHHHHHHTccGGGccEEEccTTcEEEETTEEEEEEEcccHcEEEEEccccHHHTcccTTcccccGGGGGcHHTccHHHHcEEEEEEETTEEEEEcTETccccTTHHHHHHHccccEEEEcEcccccTTccccccHHHHHHHHHHHTccEEEEEcTTccccHHHHHHHc############### DISOP:02AL 1-1| PSIPRED ccEEEEEEEEcccccccccccccEEEEEEEccEEEEEEccccHHHHHHHHHccccHHHccEEEEEcccccHHccHHHHHHHccccEEEEccHHHHHHHHcccccccccccccccHHHHHHcccEEEEEEccEEEcccEEEEEccccEEEEEEcccEEEEEcccccccccccccEEEEEEccccEEEEEccccccHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccEEEcccccEEEc //