[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49973.1
DDBJ      :             transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  743/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.94.1
:303 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   90->248 1al3A PDBj 4e-13 26.9 %
:RPS:PDB   1->238 1b9nB PDBj 1e-31 11.2 %
:RPS:SCOP  1->102 1b9mA1  a.4.5.8 * 3e-20 16.7 %
:RPS:SCOP  89->292 1i69A  c.94.1.1 * 2e-40 20.5 %
:HMM:SCOP  1->112 1b9mA1 a.4.5.8 * 1.3e-21 30.5 %
:HMM:SCOP  82->295 1uthA_ c.94.1.1 * 2.8e-40 27.6 %
:RPS:PFM   3->62 PF00126 * HTH_1 3e-07 36.7 %
:RPS:PFM   90->292 PF03466 * LysR_substrate 6e-26 29.5 %
:HMM:PFM   87->293 PF03466 * LysR_substrate 6.9e-49 30.9 204/209  
:HMM:PFM   3->62 PF00126 * HTH_1 1.5e-17 40.0 60/60  
:BLT:SWISS 3->288 RBCR_EMIHU 5e-46 34.5 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49973.1 GT:GENE ABO49973.1 GT:PRODUCT transcriptional regulator GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1564994..1565905) GB:FROM 1564994 GB:TO 1565905 GB:DIRECTION - GB:PRODUCT transcriptional regulator GB:NOTE PFAM: regulatory protein, LysR; LysR, substrate-binding KEGG: chy:CHY_0013 transcriptional regulator, LysR family GB:PROTEIN_ID ABO49973.1 GB:DB_XREF GI:134052002 InterPro:IPR000847 InterPro:IPR005119 LENGTH 303 SQ:AASEQ MNLSHFKVFKILAQTENITKASKLLELSQPTINHNIYLLEQHYGAKLFDRSNKKLKLTRFGEVLVKYVNQILNLVEQSEQHIHELVGELRGSLNLGASHTIAENVLPKIMGMFNHDYPEVTIHLEVTNTRHIVDHILDNKLDLGLIEGPVTHDNIISKPFMEDELLVVLPYNHPLAIKKNLTIKEVANLPFVLREEGSGTRVVMESTLKGAGLDPSDLNTVMELGNTQAVIGAVEAGLGATILSGLAVSKEIQLKTVKTCRISNVNIVRNFSIIINKEKPSSSIIQTFLGFINSEEIKKIFKV GT:EXON 1|1-303:0| BL:SWS:NREP 1 BL:SWS:REP 3->288|RBCR_EMIHU|5e-46|34.5|284/314| COIL:NAA 16 COIL:NSEG 1 COIL:REGION 66->81| BL:PDB:NREP 1 BL:PDB:REP 90->248|1al3A|4e-13|26.9|156/237| RP:PDB:NREP 1 RP:PDB:REP 1->238|1b9nB|1e-31|11.2|224/245| RP:PFM:NREP 2 RP:PFM:REP 3->62|PF00126|3e-07|36.7|60/60|HTH_1| RP:PFM:REP 90->292|PF03466|6e-26|29.5|200/207|LysR_substrate| HM:PFM:NREP 2 HM:PFM:REP 87->293|PF03466|6.9e-49|30.9|204/209|LysR_substrate| HM:PFM:REP 3->62|PF00126|1.5e-17|40.0|60/60|HTH_1| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00126|IPR000847| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00126|IPR000847| RP:SCP:NREP 2 RP:SCP:REP 1->102|1b9mA1|3e-20|16.7|102/122|a.4.5.8| RP:SCP:REP 89->292|1i69A|2e-40|20.5|195/206|c.94.1.1| HM:SCP:REP 1->112|1b9mA1|1.3e-21|30.5|105/0|a.4.5.8|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 82->295|1uthA_|2.8e-40|27.6|210/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 8219 OP:NHOMOORG 765 OP:PATTERN ----------1--1---------1-----------11111111----------1-------------- 4563C324665321B6511-14113C1111134565AFRV-638223211127773-4--222176HBEA3-33313422586211112221-211---11721271315---------------1---1----1-45534---317336445343311111135388662111111111111231-----53IEEEEEFEE7DDEFFED6DCFIECG244D572788877Rg2335555355443557346964558754533CD44884664254132331111-22-----------111111--111112--111---3-65DF666678646538994222B411287921IK552312633221-141225333--1--66MJQ54C8F9B79A9A98A889F-9CF9BVDLBH4-fMMKGJFWUJLJRP7429DK56585GIDCDDDDDD89BB6556-------------------------------9J22L*oXnpss*urPOMNLhh*vUTTUIV*h*h**r14VUJAFLGGrIg8uQBG96557MB33445344447BE6241524123A333-635647652664594134-21-1111-1---------13122DCGCKC99N6EGCDFFGE6EDHEFEDGFIEJH2-1454A1-----KHQNBJILNMGLGGENL-NLKLMFDLJKNFLKKKLKIakZPMAFDLDLILKNKLKKHMHIKXEFEFFEG5-F9A9AA99AAAA--1711111676647IIg888838355556545OPLRQEM699R7YYaYajWhHgjgcARNQ4531345356BGIRGGGGGDJMHGACFEGEF78732221-3222------------1-------------------------------------351 -------------3------------------------------------------------------------------------------------------------------------------------------------------------9----1-1----5----1--------12--7-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 302 STR:RPRED 99.7 SQ:SECSTR EcHHHHHHHHHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHTccccccTTccEcccHHHHHHHHHHHHHHHHHHHHHHHHHcTTccccccHHHHHHTTTccTccccccEEEEEEEcccEEEEEETTcccEEEEEccHHHHHHHTccTTcEEEGGGcEEEccHHHHTTccEEEEEEEEEEEEcccEEEEEEEcTTccEEEEEEEHGGGcTTccTTccEEEcEEEEEEcGGGcEEEcccEEEEEGGGcHcTTTcTTcEEEEccTTcccEEEEEEEETTccccHHHHHHHHHHcccTTHHHHT# DISOP:02AL 85-86| PSIPRED ccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccEEEEccccccccEEEEEEEcccEEEEEcccccccccccccHHHHccccEEEcccccHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHccccEEEEEHHHHHHHHccccEEEEEccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcc //