[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49982.1
DDBJ      :             conserved hypothetical protein 698
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  45/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:498 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   143->461 PF03601 * Cons_hypoth698 2e-17 34.8 %
:HMM:PFM   149->463 PF03601 * Cons_hypoth698 5.7e-28 25.2 270/305  
:BLT:SWISS 16->497 Y724_NITEU 7e-91 37.2 %
:TM
:REPEAT 2|34->135|136->218

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49982.1 GT:GENE ABO49982.1 GT:PRODUCT conserved hypothetical protein 698 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1575367..1576863 GB:FROM 1575367 GB:TO 1576863 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein 698 GB:NOTE PFAM: conserved hypothetical protein 698 KEGG: dsy:DSY0304 hypothetical protein GB:PROTEIN_ID ABO49982.1 GB:DB_XREF GI:134052011 InterPro:IPR004630 LENGTH 498 SQ:AASEQ MIHTDTNASVSGKVPMLKNEDWWAVWLGLFIFVLGLGPIFGADLLGWVVKVTTWTDISKSFGPMSKAYKETMSGPASLFLTYLFMLVLTTIGAKAMGASVKRFAIGFTTIFVITILCMIVGENAYIAASPDKQAKLGISWSMGLGEMGFIIAMIVGLVIGNFFPKVANYLEEAAKPEWFIKTGIVILGAAIGVKTLGALGLASTVIIRGICAVVEAYLIYWPVVYFISRKYFKFTPEWAAPLASGISICGVSAAIATGGAIRSRPIVPVILSAVIIVFVAVEMLILPWLGQTFLYEEPMVAGAWMGLAVKSDGGAVASGAITDSMIRAKALKETGVKYEEGWMLMAATTTKVFIDIFIGVWAFILAIIWSVFKLNEKGGKSSAGERGRVSASEIWDRFPKFVIGFALTFILLLIWGLNDPGIVKAAKTGTDHANGFRTLFFALCFFSIGLITNVRKLWDAGMGRIVAVYTICLFGFILWVGLFISWIFYHGILPPIVG GT:EXON 1|1-498:0| BL:SWS:NREP 1 BL:SWS:REP 16->497|Y724_NITEU|7e-91|37.2|473/487| TM:NTM 11 TM:REGION 27->49| TM:REGION 73->95| TM:REGION 103->125| TM:REGION 143->165| TM:REGION 180->202| TM:REGION 207->228| TM:REGION 272->294| TM:REGION 350->372| TM:REGION 397->419| TM:REGION 433->454| TM:REGION 468->490| NREPEAT 1 REPEAT 2|34->135|136->218| RP:PFM:NREP 1 RP:PFM:REP 143->461|PF03601|2e-17|34.8|273/303|Cons_hypoth698| HM:PFM:NREP 1 HM:PFM:REP 149->463|PF03601|5.7e-28|25.2|270/305|Cons_hypoth698| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF03601|IPR018383| OP:NHOMO 71 OP:NHOMOORG 57 OP:PATTERN -------------------21112-----11------------------------------------- -1------------111-----------------------------------------------------1------------------------------1---11--1------------------------------------------------------------1--------------------1------------------------------------------------------------------------------------------------------------------------------------1-----------------1------------133-2---112--------11------------11---------------------------------------------------------------------------------------------------------------------------------1--------1------------------------------------1-1--------211111222----------1111---1-------------------------------1----------------------------1------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------- ------1------------------------------------------------------------------------------------------------121--2------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,61-71,374-389| PSIPRED cccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHcccHHccccHHHHHHcccHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHHHHccccccEEEEEHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccEEEEEHHHHHHHHHHHHHHHHHHHHHHcccccc //