[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49991.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   75->164 1vrrA PDBj 6e-04 27.2 %
:HMM:SCOP  2->166 1sdoA_ c.52.1.21 * 1e-39 35.9 %
:RPS:PFM   13->165 PF09195 * Endonuc-BglII 1e-14 38.0 %
:HMM:PFM   18->165 PF09195 * Endonuc-BglII 3e-35 33.8 142/164  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49991.1 GT:GENE ABO49991.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1590908..1591411) GB:FROM 1590908 GB:TO 1591411 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABO49991.1 GB:DB_XREF GI:134052020 LENGTH 167 SQ:AASEQ MRIILQKNYYRSAHDFITPDVEAEINQLLLEPTIDLSSLSRSHYNQLLREMFKRNGWQNSPSLFHDPVNPLAKIELLKNNIGLEIGFRHVSLTGHNLLKFQLSPLHNSDKIDVGIFIVSTNNFQKQIRKTFCHNWTGAMSFEKTDRYLRNFKTAIQIPIYLIGIDAA GT:EXON 1|1-167:0| BL:PDB:NREP 1 BL:PDB:REP 75->164|1vrrA|6e-04|27.2|81/203| RP:PFM:NREP 1 RP:PFM:REP 13->165|PF09195|1e-14|38.0|142/155|Endonuc-BglII| HM:PFM:NREP 1 HM:PFM:REP 18->165|PF09195|3e-35|33.8|142/164|Endonuc-BglII| HM:SCP:REP 2->166|1sdoA_|1e-39|35.9|156/0|c.52.1.21|1/1|Restriction endonuclease-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 48.5 SQ:SECSTR ##########################################################################EEEETTEEEEEccccTHHHHHHHHTHHHH#HHHTTcccEEEEEEEcHHHHTTc########cTTcccHHHHHHHTcTTccccccEEEEEE### DISOP:02AL 6-6| PSIPRED cEEEEEccccHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccHHHcccccHHHHHHHHcccccEEEEEEEEEEEcccEEEEEEccccccccEEEEEEEEEccHHHHHHHHHHHccccccccHHHHHHHHHHHHHEEEEEEEEEEEEcc //