[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49995.1
DDBJ      :             SpoVA protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  79/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   84->134 PF03862 * SpoVA 4e-14 64.7 %
:HMM:PFM   32->149 PF03862 * SpoVA 2.9e-47 51.3 117/119  
:BLT:SWISS 9->134 SP5AC_BACSU 1e-27 57.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49995.1 GT:GENE ABO49995.1 GT:PRODUCT SpoVA protein GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION complement(1593369..1593848) GB:FROM 1593369 GB:TO 1593848 GB:DIRECTION - GB:PRODUCT SpoVA protein GB:NOTE PFAM: SpoVA protein KEGG: gka:GK0853 stage V sporulation protein AC GB:PROTEIN_ID ABO49995.1 GB:DB_XREF GI:134052024 InterPro:IPR005562 LENGTH 159 SQ:AASEQ MSNKKKKKLTPTQQEYYAFAKAREPKRPVVTNVCRAFLAGGIICVIGQGIQDFFIWHFDFTEKTAGSPTVAILILVSVILTSLGVYDHIAQWAGAGTAVPVTGFANSIASAAIEHRTEGYVLGVGGNMFKLAGSVVVFGVFAAFVVALIKTALAALGVG GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 9->134|SP5AC_BACSU|1e-27|57.1|126/100| TM:NTM 4 TM:REGION 28->50| TM:REGION 65->87| TM:REGION 90->112| TM:REGION 127->149| SEG 40->51|ggiicvigqgiq| SEG 69->83|tvaililvsviltsl| SEG 135->147|vvvfgvfaafvva| RP:PFM:NREP 1 RP:PFM:REP 84->134|PF03862|4e-14|64.7|51/112|SpoVA| HM:PFM:NREP 1 HM:PFM:REP 32->149|PF03862|2.9e-47|51.3|117/119|SpoVA| OP:NHOMO 112 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21122222222223322322111122222211--------22------------------------------------------------------------------------------------------12111111121112111111111111--1111111121111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16| PSIPRED ccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //