[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO49999.1
DDBJ      :             protein of unknown function DUF421
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  208/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   91->209 3c6fD PDBj 3e-21 38.7 %
:RPS:PDB   91->223 3c6fA PDBj 4e-19 35.3 %
:RPS:PFM   89->155 PF04239 * DUF421 2e-12 49.3 %
:HMM:PFM   84->159 PF04239 * DUF421 4.9e-28 45.3 75/99  
:HMM:PFM   164->223 PF04239 * DUF421 1.5e-08 38.3 60/99  
:BLT:SWISS 1->223 YRBG_BACSU 2e-36 33.6 %
:TM
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO49999.1 GT:GENE ABO49999.1 GT:PRODUCT protein of unknown function DUF421 GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1595420..1596100 GB:FROM 1595420 GB:TO 1596100 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF421 GB:NOTE PFAM: protein of unknown function DUF421 KEGG: swo:Swol_0321 hypothetical protein GB:PROTEIN_ID ABO49999.1 GB:DB_XREF GI:134052028 InterPro:IPR007353 LENGTH 226 SQ:AASEQ MILVMIRTLILFTLVVLALRIMGKRQIGKLQPYELVIIIMLAELASIPMADNRFPLVSGVVAIITLLFVEILISYTSLKSERLREFVCGTPSILIENGKIVEQELKRLRYNINDLLEQLRSKNFPDITDVEFAVLETSGEISVIPKSQKRAVSPEDLNIPTEYEGLPITLIIDGFVFEKNLSKFNLSKEWLKDEFSKFGIYDSKQVLFASLDTKGNLFYQLKNKMA GT:EXON 1|1-226:0| BL:SWS:NREP 1 BL:SWS:REP 1->223|YRBG_BACSU|2e-36|33.6|211/218| COIL:NAA 28 COIL:NSEG 1 COIL:REGION 94->121| TM:NTM 3 TM:REGION 2->23| TM:REGION 29->51| TM:REGION 56->78| BL:PDB:NREP 1 BL:PDB:REP 91->209|3c6fD|3e-21|38.7|119/138| RP:PDB:NREP 1 RP:PDB:REP 91->223|3c6fA|4e-19|35.3|133/137| RP:PFM:NREP 1 RP:PFM:REP 89->155|PF04239|2e-12|49.3|67/80|DUF421| HM:PFM:NREP 2 HM:PFM:REP 84->159|PF04239|4.9e-28|45.3|75/99|DUF421| HM:PFM:REP 164->223|PF04239|1.5e-08|38.3|60/99|DUF421| OP:NHOMO 393 OP:NHOMOORG 211 OP:PATTERN ----------------------------------------------1-----1--------------- -----111---1-------------1-------111---1-------------------------1----1-----------1------------------213---4-1-------------------------------------211-----------------111--------------1------13444444557348565738662574522163--------44---------------------------------11-------------------------------------------------------24253222335313131222111121--2--2133352342111111--1--1---1--1---------------------------21-1----1-1---------1111------1111-1------------------------------------------------------------------------11--------1-1---------2-11--------1-------------11-1---------------------------1-----------------------------------1----2------------------------1----------2---2-1111111111-1111111111111111111121----11111111111111111-111---1--1----------------111--------1----------------11111---21-------1----1--1--1-------------------------1----------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 58.8 SQ:SECSTR ##########################################################################################cEEEEETTEEcHHHHHHTTccHHHHHHHHHHTTcccGGGEEEEEEcTTccEEEEEcGGGccccTTTTTcccccccccEEEEETTEEcHHHHHHHcccHHHHHHHHHHTTcccGGGEEEEEEcTTcccEEEETT### DISOP:02AL 150-158,226-227| PSIPRED cHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHccccHHHHHHHHHHcccccHHHEEEEEEEccccEEEEEccccccccHHHccccccccccEEEEEEccEEcHHHHHHccccHHHHHHHHHHcccccHHHEEEEEEEccccEEEEEHHHcc //