[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Desulfotomaculum reducens MI-1 (dred0)
Gene : ABO50004.1
DDBJ      :             type IV pilus assembly PilZ
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.45.2
:98 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  5->83 1ywuA1  b.45.2.1 * 5e-10 19.5 %
:HMM:SCOP  4->87 1ywuA1 b.45.2.1 * 2.4e-09 20.3 %
:HMM:PFM   6->83 PF07238 * PilZ 6.5e-13 19.2 78/102  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABO50004.1 GT:GENE ABO50004.1 GT:PRODUCT type IV pilus assembly PilZ GT:DATABASE GIB00494CH01 GT:ORG dred0 GB:ACCESSION GIB00494CH01 GB:LOCATION 1601795..1602091 GB:FROM 1601795 GB:TO 1602091 GB:DIRECTION + GB:PRODUCT type IV pilus assembly PilZ GB:NOTE PFAM: type IV pilus assembly PilZ GB:PROTEIN_ID ABO50004.1 GB:DB_XREF GI:134052033 InterPro:IPR009875 LENGTH 98 SQ:AASEQ MDIARERRKHKRYEIELQAIISKNDHRYLQNVKLINISGGGISFTCDNQIAIGETIMIYFPFITVQGYVIWQQGNRYGAMFQNPLGDELQIFLTKHCE GT:EXON 1|1-98:0| TM:NTM 1 TM:REGION 50->72| HM:PFM:NREP 1 HM:PFM:REP 6->83|PF07238|6.5e-13|19.2|78/102|PilZ| RP:SCP:NREP 1 RP:SCP:REP 5->83|1ywuA1|5e-10|19.5|77/125|b.45.2.1| HM:SCP:REP 4->87|1ywuA1|2.4e-09|20.3|79/0|b.45.2.1|1/1|PilZ domain-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,98-99| PSIPRED ccHHHHHHHHHEEEEEEEEEEEEccEEEEccccEEEEEcccEEEEcHHHHHcccEEEEEEEEEEEEEEEEEEcccEEEEEEEcccccEEEEEEEEccc //